Views: [Report Format] [FASTA Format] [Graphical View] [Save As...]
Links: [2 MEDLINE links] [4 protein links] [3 Related Nucleotide sequences]
LOCUS       ECOTRPR      1289 bp    DNA             BCT       22-SEP-1986
DEFINITION  E.coli trpR gene coding for the trp operon repressor protein.
ACCESSION   J01715 V00369
NID         g148059
KEYWORDS    DNA-binding protein; repressor; trp repressor; trpR gene.
SOURCE      Escherichia coli DNA [1],[2] and mRNA [2].
  ORGANISM  Escherichia coli
            Eubacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae;
            Escherichia.
REFERENCE   1  (bases 1 to 1041)
  AUTHORS   Singleton,C.K., Roeder,W.D., Bogosian,G., Somerville,R.L. and
            Weith,H.L.
  TITLE     DNA sequence of the E.coli trpR gene and prediction of the amino
            acid sequence of Trp repressor
  JOURNAL   Nucleic Acids Res. 8, 1551-1560 (1980)
  MEDLINE   81053831
REFERENCE   2  (bases 275 to 831)
  AUTHORS   Gunsalus,R.P. and Yanofsky,C.
  TITLE     Nucleotide sequence and expression of Escherichia coli trpR, the
            structural gene for the trp aporepressor
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 77, 7117-7121 (1980)
  MEDLINE   81175101
REFERENCE   3  (bases 1 to 1042)
  AUTHORS   Bogosian,G.
  JOURNAL   Unpublished (1986)
REFERENCE   4  (bases 1 to 1289)
  AUTHORS   Bogosian,G.
  TITLE     no plans to publish
  JOURNAL   Unpublished (1990)
COMMENT     [3]  revises [1].
            [2] experimentally determined the promoter region for trpR by
            determining which restriction sites are protected in the presence
            of the TrpR protein and RNA polymerase. The trpR promoter region is
            highly homologous to the trp and aroH promoter regions, which are
            also controlled by the trpR gene product.
FEATURES             Location/Qualifiers
     source          1..1289
                     /organism="Escherichia coli"
     misc_signal     316..343
                     /note="trpR promoter region [2] (experimental,
                     approximate)"
     mRNA            329..711
                     /partial
                     /note="trpR mRNA [2]"
     CDS             385..711
                     /note="trp operon repressor protein (trpR)"
                     /codon_start=1
                     /db_xref="PID:g148060"
                     /transl_table=11
                     /translation="MAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLT
                     PDEREALGTRVRIVEELLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEE
                     VLLKSD"
     CDS             765..1178
                     /codon_start=1
                     /label=orf-173
                     /db_xref="PID:g148061"
                     /transl_table=11
                     /translation="MRREGLIRPTNTRNFNMFGRHDKTRQRRIRRLIHGIMKRTQRQD
                     HRLVIDAGASEFPGGKHADRPFLTTDLINTGITRHHGTKRLTFTHFFQNHRRQRQSSR
                     TRLAALAGVFNHHPTESAVTIDASFNRHPKISLWK"
     CDS             813..1178
                     /codon_start=1
                     /label=orf-121
                     /db_xref="PID:g148062"
                     /transl_table=11
                     /translation="MFGRHDKTRQRRIRRLIHGIMKRTQRQDHRLVIDAGASEFPGGK
                     HADRPFLTTDLINTGITRHHGTKRLTFTHFFQNHRRQRQSSRTRLAALAGVFNHHPTE
                     SAVTIDASFNRHPKISLWK"
     CDS             873..1178
                     /codon_start=1
                     /label=orf-101
                     /db_xref="PID:g148063"
                     /transl_table=11
                     /translation="MKRTQRQDHRLVIDAGASEFPGGKHADRPFLTTDLINTGITRHH
                     GTKRLTFTHFFQNHRRQRQSSRTRLAALAGVFNHHPTESAVTIDASFNRHPKISLWK"
BASE COUNT      309 a    352 c    346 g    282 t
ORIGIN      BamHI site [Nucleic Acids Res. 8, 1551-1560 (1980)]; 99.8 min on K.
        1 ggatccggaa acgaatatca acattggcac cagttacctg caatatgttt atcagcagtt
       61 tggcaataat cgtattttct cctcagcagc ttataacgcc ggactagggc gggtgcgaac
      121 ctggcttggc aacagcgccg ggcgtatcga cgcagtggca tttgtcgaga gtattccatt
      181 ctccgagacg cgcggttatg tgaagaacgt gctggcttat gacgcttact accgctattt
      241 catgggggat aaaccgacgt tgatgagcgc cacggaatgg ggacgtcgtt actgatccgc
      301 acgtttatga tatgctatcg tactctttag cgagtacaac cgggggaggc attttgcttc
      361 ccccgctaac aatggcgaca tattatggcc caacaatcac cctattcagc agcgatggca
      421 gaacagcgtc accaggagtg gttacgtttt gtcgacctgc ttaagaatgc ctaccaaaac
      481 gatctccatt taccgttgtt aaacctgatg ctgacgccag atgagcgcga agcgttgggg
      541 actcgcgtgc gtattgtcga agagctgttg cgcggcgaaa tgagccagcg tgagttaaaa
      601 aatgaactcg gcgcaggcat cgcgacgatt acgcgtggat ctaacagcct gaaagccgcg
      661 cccgtcgagc tgcgccagtg gctggaagag gtgttgctga aaagcgattg attttgtagg
      721 cctgataaga cgtggcgcat caggcatcgt gcaccgaatg ccggatgcgg cgtgaaggcc
      781 ttatccgtcc tacaaatacc cgtaatttca atatgtttgg taggcatgat aagacgcggc
      841 agcgtcgcat caggcgctta atacacggca ttatgaaacg gactcagcgc caggatcacc
      901 gcctggtgat agacgctggc gcgagtgagt ttcccggcgg taaacacgcc gatcgcccct
      961 tccttacgac cgatctcatc aataccggta taacgcgaca tcacgggacc aagcgcctca
     1021 ccttcacgca ctttttccag aatcaccgca ggcaacggca aagtagccga acgcgcctcg
     1081 ccgcgctggc tggcgttttc aatcaccacc caactgaaag tgctgtcacc atcgatgcca
     1141 gcttcaatcg ccacccaaaa atcagcctct ggaagtaaac ggcgggcatt ggctacccga
     1201 tttcgtgcgc cagcgcgcgt ttcctcactg ccaaagggct gttccggtac accgctctcg
     1261 acggcaacgg atgcaatatg gcaggatcc
//