LOCUS ECOTRPR 1289 bp DNA BCT 22-SEP-1986
DEFINITION E.coli trpR gene coding for the trp operon repressor protein.
ACCESSION J01715 V00369
NID g148059
KEYWORDS DNA-binding protein; repressor; trp repressor; trpR gene.
SOURCE Escherichia coli DNA [1],[2] and mRNA [2].
ORGANISM Escherichia coli
Eubacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae;
Escherichia.
REFERENCE 1 (bases 1 to 1041)
AUTHORS Singleton,C.K., Roeder,W.D., Bogosian,G., Somerville,R.L. and
Weith,H.L.
TITLE DNA sequence of the E.coli trpR gene and prediction of the amino
acid sequence of Trp repressor
JOURNAL Nucleic Acids Res. 8, 1551-1560 (1980)
MEDLINE 81053831
REFERENCE 2 (bases 275 to 831)
AUTHORS Gunsalus,R.P. and Yanofsky,C.
TITLE Nucleotide sequence and expression of Escherichia coli trpR, the
structural gene for the trp aporepressor
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 77, 7117-7121 (1980)
MEDLINE 81175101
REFERENCE 3 (bases 1 to 1042)
AUTHORS Bogosian,G.
JOURNAL Unpublished (1986)
REFERENCE 4 (bases 1 to 1289)
AUTHORS Bogosian,G.
TITLE no plans to publish
JOURNAL Unpublished (1990)
COMMENT [3] revises [1].
[2] experimentally determined the promoter region for trpR by
determining which restriction sites are protected in the presence
of the TrpR protein and RNA polymerase. The trpR promoter region is
highly homologous to the trp and aroH promoter regions, which are
also controlled by the trpR gene product.
FEATURES Location/Qualifiers
source 1..1289
/organism="Escherichia coli"
misc_signal 316..343
/note="trpR promoter region [2] (experimental,
approximate)"
mRNA 329..711
/partial
/note="trpR mRNA [2]"
CDS 385..711
/note="trp operon repressor protein (trpR)"
/codon_start=1
/db_xref="PID:g148060"
/transl_table=11
/translation=" MAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLT
PDEREALGTRVRIVEELLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEE
VLLKSD"
CDS 765..1178
/codon_start=1
/label=orf-173
/db_xref="PID:g148061"
/transl_table=11
/translation="MRREGLIRPTNTRNFNMFGRHDKTRQRRIRRLIHGIMKRTQRQD
HRLVIDAGASEFPGGKHADRPFLTTDLINTGITRHHGTKRLTFTHFFQNHRRQRQSSR
TRLAALAGVFNHHPTESAVTIDASFNRHPKISLWK"
CDS 813..1178
/codon_start=1
/label=orf-121
/db_xref="PID:g148062"
/transl_table=11
/translation="MFGRHDKTRQRRIRRLIHGIMKRTQRQDHRLVIDAGASEFPGGK
HADRPFLTTDLINTGITRHHGTKRLTFTHFFQNHRRQRQSSRTRLAALAGVFNHHPTE
SAVTIDASFNRHPKISLWK"
CDS 873..1178
/codon_start=1
/label=orf-101
/db_xref="PID:g148063"
/transl_table=11
/translation="MKRTQRQDHRLVIDAGASEFPGGKHADRPFLTTDLINTGITRHH
GTKRLTFTHFFQNHRRQRQSSRTRLAALAGVFNHHPTESAVTIDASFNRHPKISLWK"
BASE COUNT 309 a 352 c 346 g 282 t
ORIGIN BamHI site [Nucleic Acids Res. 8, 1551-1560 (1980)]; 99.8 min on K.
1 ggatccggaa acgaatatca acattggcac cagttacctg caatatgttt atcagcagtt
61 tggcaataat cgtattttct cctcagcagc ttataacgcc ggactagggc gggtgcgaac
121 ctggcttggc aacagcgccg ggcgtatcga cgcagtggca tttgtcgaga gtattccatt
181 ctccgagacg cgcggttatg tgaagaacgt gctggcttat gacgcttact accgctattt
241 catgggggat aaaccgacgt tgatgagcgc cacggaatgg ggacgtcgtt actgatccgc
301 acgtttatga tatgctatcg tactctttag cgagtacaac cgggggaggc attttgcttc
361 ccccgctaac aatggcgaca tattatggcc caacaatcac cctattcagc agcgatggca
421 gaacagcgtc accaggagtg gttacgtttt gtcgacctgc ttaagaatgc ctaccaaaac
481 gatctccatt taccgttgtt aaacctgatg ctgacgccag atgagcgcga agcgttgggg
541 actcgcgtgc gtattgtcga agagctgttg cgcggcgaaa tgagccagcg tgagttaaaa
601 aatgaactcg gcgcaggcat cgcgacgatt acgcgtggat ctaacagcct gaaagccgcg
661 cccgtcgagc tgcgccagtg gctggaagag gtgttgctga aaagcgattg attttgtagg
721 cctgataaga cgtggcgcat caggcatcgt gcaccgaatg ccggatgcgg cgtgaaggcc
781 ttatccgtcc tacaaatacc cgtaatttca atatgtttgg taggcatgat aagacgcggc
841 agcgtcgcat caggcgctta atacacggca ttatgaaacg gactcagcgc caggatcacc
901 gcctggtgat agacgctggc gcgagtgagt ttcccggcgg taaacacgcc gatcgcccct
961 tccttacgac cgatctcatc aataccggta taacgcgaca tcacgggacc aagcgcctca
1021 ccttcacgca ctttttccag aatcaccgca ggcaacggca aagtagccga acgcgcctcg
1081 ccgcgctggc tggcgttttc aatcaccacc caactgaaag tgctgtcacc atcgatgcca
1141 gcttcaatcg ccacccaaaa atcagcctct ggaagtaaac ggcgggcatt ggctacccga
1201 tttcgtgcgc cagcgcgcgt ttcctcactg ccaaagggct gttccggtac accgctctcg
1261 acggcaacgg atgcaatatg gcaggatcc