David Liu, same guy from last homework, would also like to know the DNA binding region of the protein you translated for him in the last homework. (1) Could you tell him the residue number corresponding to the DNA binding region in the sequence? (Hint : check SWISS-PROT!)

DNA_BIND 79 147
ERQTADELRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERLRVQHLRDHPNYK
 

(2) Could you tell him the name of this DNA binding region?

HMG BOX.
 

(3) David would like to see its structure. Could you help him to make a model of this DNA binding region? Show structure on your homwpage ( at least 3 different rasmol pictures).