Protease inhibitor domain of Alzheimer's amyloid compnd beta-protein precurser

1. sequence (58 amino acids)

VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSA

 
2. structure