Version 2.0 

BLASTP Results

Compares an amino acid query sequence against a protein sequence.

Algorithm Citation:
Altschul, Stephen F., Warren Gish, Webb Miller, Eugene W. Myers, and David J. Lipman (1990). Basic local alignment search tool. J. Mol. Biol. 215:403-10.
Program Citation:
National Center for Biotechnology Information,Bldg 38A, NIH,8600 Rockville Pike,Bethesda, MD 20894

new protein
Query=  26050
        (60 letters)
Database:  pdb.db.prot
           9717 sequences; 1,888,416 total letters.




Check Sequences and then Press 'Import to Workbench' to Import them to the Workbench

Smallest Sum High Probability Sequences producing High-scoring Segment Pairs: Score P(N) N 

Accession: pdb|CARDIOTOXIN|2CRS__ Cardiotoxin iii (NMR, 13 structures)
pdb|CARDIOTOXIN|2CRS__ Cardiotoxin iii (NMR, 13 structures)

Length = 60

Score = 329 (158.8 bits)
Expect = 1.5e-44
P = 1.5e-44
Identities = 56/60 (93%)
Positives = 60/60 (100%)

Query:     1 LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             LKCNKLVPLFYKTCPAGKN+CYKMFMVATPK+PVKRGCIDVCPKSSLLV+YVCCNTD+CN
Subject:   1 LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN 60

Accession: pdb|CARDIOTOXIN|2CRT__ Cardiotoxin iii (NMR, minimized average structure)
pdb|CARDIOTOXIN|2CRT__ Cardiotoxin iii (NMR, minimized average structure)

Length = 60

Score = 329 (158.8 bits)
Expect = 1.5e-44
P = 1.5e-44
Identities = 56/60 (93%)
Positives = 60/60 (100%)

Query:     1 LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             LKCNKLVPLFYKTCPAGKN+CYKMFMVATPK+PVKRGCIDVCPKSSLLV+YVCCNTD+CN
Subject:   1 LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN 60

Accession: pdb|CARDIOTOXIN|1CRE__ Cardiotoxin ii (NMR, minimized average structure)
pdb|CARDIOTOXIN|1CRE__ Cardiotoxin ii (NMR, minimized average structure)

Length = 60

Score = 297 (143.3 bits)
Expect = 6.5e-40
P = 6.5e-40
Identities = 50/60 (83%)
Positives = 56/60 (93%)

Query:     1 LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             LKCNKLVPLFYKTCPAGKN+CYKMFMV+   +PVKRGCIDVCPK+S LV+YVCCNTD+CN
Subject:   1 LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN 60

Accession: pdb|CARDIOTOXIN|1CRF__ Cardiotoxin ii (NMR, 12 structures)
pdb|CARDIOTOXIN|1CRF__ Cardiotoxin ii (NMR, 12 structures)

Length = 60

Score = 297 (143.3 bits)
Expect = 6.5e-40
P = 6.5e-40
Identities = 50/60 (83%)
Positives = 56/60 (93%)

Query:     1 LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             LKCNKLVPLFYKTCPAGKN+CYKMFMV+   +PVKRGCIDVCPK+S LV+YVCCNTD+CN
Subject:   1 LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN 60

Accession: pdb|CYTOTOXIN|1CXN__ Cardiotoxin gamma (NMR, minimized average structure)
pdb|CYTOTOXIN|1CXN__ Cardiotoxin gamma (NMR, minimized average structure)

Length = 60

Score = 280 (135.1 bits)
Expect = 1.9e-37
P = 1.9e-37
Identities = 46/60 (76%)
Positives = 54/60 (90%)

Query:     1 LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             LKCN+L+P F+KTCP GKN+CYKM M A P +PVKRGCIDVCPKSSLL++Y+CCNTDKCN
Subject:   1 LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN 60

Accession: pdb|CYTOTOXIN|1CXO__ Cardiotoxin gamma (NMR, 9 structures)
pdb|CYTOTOXIN|1CXO__ Cardiotoxin gamma (NMR, 9 structures)

Length = 60

Score = 280 (135.1 bits)
Expect = 1.9e-37
P = 1.9e-37
Identities = 46/60 (76%)
Positives = 54/60 (90%)

Query:     1 LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             LKCN+L+P F+KTCP GKN+CYKM M A P +PVKRGCIDVCPKSSLL++Y+CCNTDKCN
Subject:   1 LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN 60

Accession: pdb|CYTOTOXIN|1TGX_A Toxin gamma (cardiotoxin)
pdb|CYTOTOXIN|1TGX_A Toxin gamma (cardiotoxin)

Length = 60

Score = 280 (135.1 bits)
Expect = 1.9e-37
P = 1.9e-37
Identities = 46/60 (76%)
Positives = 54/60 (90%)

Query:     1 LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             LKCN+L+P F+KTCP GKN+CYKM M A P +PVKRGCIDVCPKSSLL++Y+CCNTDKCN
Subject:   1 LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN 60

Accession: pdb|CYTOTOXIN|1TGX_B Toxin gamma (cardiotoxin)
pdb|CYTOTOXIN|1TGX_B Toxin gamma (cardiotoxin)

Length = 60

Score = 280 (135.1 bits)
Expect = 1.9e-37
P = 1.9e-37
Identities = 46/60 (76%)
Positives = 54/60 (90%)

Query:     1 LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             LKCN+L+P F+KTCP GKN+CYKM M A P +PVKRGCIDVCPKSSLL++Y+CCNTDKCN
Subject:   1 LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN 60

Accession: pdb|CYTOTOXIN|1TGX_C Toxin gamma (cardiotoxin)
pdb|CYTOTOXIN|1TGX_C Toxin gamma (cardiotoxin)

Length = 60

Score = 280 (135.1 bits)
Expect = 1.9e-37
P = 1.9e-37
Identities = 46/60 (76%)
Positives = 54/60 (90%)

Query:     1 LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             LKCN+L+P F+KTCP GKN+CYKM M A P +PVKRGCIDVCPKSSLL++Y+CCNTDKCN
Subject:   1 LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN 60

Accession: pdb|CARDIOTOXIN|2CDX__ Cardiotoxin ctx i (NMR, 11 structures)
pdb|CARDIOTOXIN|2CDX__ Cardiotoxin ctx i (NMR, 11 structures)

Length = 60

Score = 279 (134.6 bits)
Expect = 2.7e-37
P = 2.7e-37
Identities = 46/60 (76%)
Positives = 55/60 (91%)

Query:     1 LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             LKCNKL+P+  KTCPAGKN+CYKMFM++   +PVKRGCIDVCPK+SLLV+YVCCNTD+CN
Subject:   1 LKCNKLIPIASKTCPAGKNLCYKMFMMSDLTIPVKRGCIDVCPKNSLLVKYVCCNTDRCN 60

Accession: pdb|CARDIOTOXIN|2CCX__ Cardiotoxin ctx iib (NMR, 20 structures)
pdb|CARDIOTOXIN|2CCX__ Cardiotoxin ctx iib (NMR, 20 structures)

Length = 60

Score = 275 (132.7 bits)
Expect = 1.0e-36
P = 1.0e-36
Identities = 45/60 (75%)
Positives = 54/60 (90%)

Query:     1 LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             LKCN+L+P F+KTCP GKN+CYKM M A P +PVKRGCIDVCPKSSLL++Y+CCNT+KCN
Subject:   1 LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTNKCN 60

Accession: pdb|CYTOTOXIN|1CDT_A Cardiotoxin v=4===II== (toxin III)
pdb|CYTOTOXIN|1CDT_A Cardiotoxin v=4===II== (toxin III)

Length = 60

Score = 259 (125.0 bits)
Expect = 2.2e-34
P = 2.2e-34
Identities = 41/60 (68%)
Positives = 52/60 (86%)

Query:     1 LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             LKCNKL+P+ YKTCP GKN+CYKM + +   +PVKRGCI+VCPK+S LV+YVCC+TD+CN
Subject:   1 LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN 60

Accession: pdb|CYTOTOXIN|1CDT_B Cardiotoxin v=4===II== (toxin III)
pdb|CYTOTOXIN|1CDT_B Cardiotoxin v=4===II== (toxin III)

Length = 60

Score = 259 (125.0 bits)
Expect = 2.2e-34
P = 2.2e-34
Identities = 41/60 (68%)
Positives = 52/60 (86%)

Query:     1 LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             LKCNKL+P+ YKTCP GKN+CYKM + +   +PVKRGCI+VCPK+S LV+YVCC+TD+CN
Subject:   1 LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN 60

Accession: pdb|CYTOTOXIN|1CVO__ Cardiotoxin v (NMR, 2 structures)
pdb|CYTOTOXIN|1CVO__ Cardiotoxin v (NMR, 2 structures)

Length = 62

Score = 136 (65.6 bits)
Expect = 2.1e-27
Sum P(2) = 2.1e-27
Identities = 22/30 (73%)
Positives = 26/30 (86%)

Query:    31 KLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             K PVKRGC D CPK+S L++YVCC+TDKCN
Subject:  33 KFPVKRGCADNCPKNSALLKYVCCSTDKCN 62
Score = 80 (38.6 bits)
Expect = 2.1e-27
Sum P(2) = 2.1e-27
Identities = 13/27 (48%)
Positives = 17/27 (62%)
Query:     4 NKLVPLFYKTCPAGKNICYKMFMVATP 30
             N  +P  YKTCP GKN+C+K  +   P
Subject:   5 NTQLPFIYKTCPEGKNLCFKATLKKFP 31

Accession: pdb|CYTOTOXIN|1KXI_A (ctx a5)
pdb|CYTOTOXIN|1KXI_A (ctx a5)

Length = 62

Score = 136 (65.6 bits)
Expect = 2.1e-27
Sum P(2) = 2.1e-27
Identities = 22/30 (73%)
Positives = 26/30 (86%)

Query:    31 KLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             K PVKRGC D CPK+S L++YVCC+TDKCN
Subject:  33 KFPVKRGCADNCPKNSALLKYVCCSTDKCN 62
Score = 80 (38.6 bits)
Expect = 2.1e-27
Sum P(2) = 2.1e-27
Identities = 13/27 (48%)
Positives = 17/27 (62%)
Query:     4 NKLVPLFYKTCPAGKNICYKMFMVATP 30
             N  +P  YKTCP GKN+C+K  +   P
Subject:   5 NTQLPFIYKTCPEGKNLCFKATLKKFP 31

Accession: pdb|CYTOTOXIN|1KXI_B (ctx a5)
pdb|CYTOTOXIN|1KXI_B (ctx a5)

Length = 62

Score = 136 (65.6 bits)
Expect = 2.1e-27
Sum P(2) = 2.1e-27
Identities = 22/30 (73%)
Positives = 26/30 (86%)

Query:    31 KLPVKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             K PVKRGC D CPK+S L++YVCC+TDKCN
Subject:  33 KFPVKRGCADNCPKNSALLKYVCCSTDKCN 62
Score = 80 (38.6 bits)
Expect = 2.1e-27
Sum P(2) = 2.1e-27
Identities = 13/27 (48%)
Positives = 17/27 (62%)
Query:     4 NKLVPLFYKTCPAGKNICYKMFMVATP 30
             N  +P  YKTCP GKN+C+K  +   P
Subject:   5 NTQLPFIYKTCPEGKNLCFKATLKKFP 31

Accession: pdb|TOXIN|1ABT_A Alpha-bungarotoxin complexed with the 185 - 196 fragment of
pdb|TOXIN|1ABT_A Alpha-bungarotoxin complexed with the 185 - 196 fragment of t

Length = 74

Score = 74 (35.7 bits)
Expect = 3.4e-15
Sum P(2) = 3.4e-15
Identities = 12/27 (44%)
Positives = 14/27 (51%)

Query:    34 VKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             V+ GC   CP         CC+TDKCN
Subject:  40 VELGCAATCPSKKPYEEVTCCSTDKCN 66
Score = 56 (27.0 bits)
Expect = 3.4e-15
Sum P(2) = 3.4e-15
Identities = 8/16 (50%)
Positives = 12/16 (75%)
Query:     8 PLFYKTCPAGKNICYK 23
             P+   TCP G+N+CY+
Subject:  10 PISAVTCPPGENLCYR 25

Accession: pdb|POSTSYNAPTIC NEUROTOXIN|2ABX_A Alpha-Bungarotoxin
pdb|POSTSYNAPTIC NEUROTOXIN|2ABX_A Alpha-Bungarotoxin

Length = 74

Score = 74 (35.7 bits)
Expect = 4.7e-15
Sum P(2) = 4.7e-15
Identities = 12/27 (44%)
Positives = 14/27 (51%)

Query:    34 VKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             V+ GC   CP         CC+TDKCN
Subject:  40 VELGCAATCPSKKPYEEVTCCSTDKCN 66
Score = 55 (26.5 bits)
Expect = 4.7e-15
Sum P(2) = 4.7e-15
Identities = 8/17 (47%)
Positives = 12/17 (70%)
Query:     7 VPLFYKTCPAGKNICYK 23
             +P    TCP G+N+CY+
Subject:   9 IPSSAVTCPPGENLCYR 25

Accession: pdb|POSTSYNAPTIC NEUROTOXIN|2ABX_B Alpha-Bungarotoxin
pdb|POSTSYNAPTIC NEUROTOXIN|2ABX_B Alpha-Bungarotoxin

Length = 74

Score = 74 (35.7 bits)
Expect = 4.7e-15
Sum P(2) = 4.7e-15
Identities = 12/27 (44%)
Positives = 14/27 (51%)

Query:    34 VKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             V+ GC   CP         CC+TDKCN
Subject:  40 VELGCAATCPSKKPYEEVTCCSTDKCN 66
Score = 55 (26.5 bits)
Expect = 4.7e-15
Sum P(2) = 4.7e-15
Identities = 8/17 (47%)
Positives = 12/17 (70%)
Query:     7 VPLFYKTCPAGKNICYK 23
             +P    TCP G+N+CY+
Subject:   9 IPSSAVTCPPGENLCYR 25

Accession: pdb|NEUROTOXIN|1LSI__ (long neurotoxin 1 (component lsiii))
pdb|NEUROTOXIN|1LSI__ (long neurotoxin 1 (component lsiii))

Length = 66

Score = 64 (30.9 bits)
Expect = 7.1e-13
Sum P(2) = 7.1e-13
Identities = 10/24 (41%)
Positives = 12/24 (50%)

Query:    37 GCIDVCPKSSLLVRYVCCNTDKCN 60
             GC   CP  +      CC+ DKCN
Subject:  40 GCAATCPSVNTGTEIKCCSADKCN 63
Score = 50 (24.1 bits)
Expect = 7.1e-13
Sum P(2) = 7.1e-13
Identities = 7/11 (63%)
Positives = 10/11 (90%)
Query:    12 KTCPAGKNICY 22
             +TCP+G+ ICY
Subject:  11 QTCPSGQEICY 21

Accession: pdb|POSTSYNAPTIC NEUROTOXIN|1NTN__ Neurotoxin-i
pdb|POSTSYNAPTIC NEUROTOXIN|1NTN__ Neurotoxin-i

Length = 72

Score = 62 (29.9 bits)
Expect = 4.9e-11
Sum P(2) = 4.9e-11
Identities = 10/27 (37%)
Positives = 13/27 (48%)

Query:    34 VKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             ++ GC   CP         CC+TD CN
Subject:  38 IELGCAATCPTVESYQDIKCCSTDNCN 64
Score = 49 (23.6 bits)
Expect = 4.9e-11
Sum P(2) = 4.9e-11
Identities = 8/22 (36%)
Positives = 13/22 (59%)
Query:     1 LKCNKLVPLFYKTCPAGKNICY 22
             + C K   +  +TC  G+N+CY
Subject:   1 ITCYKTPIITSETCAPGQNLCY 22

Accession: pdb|TOXIN|1TFS__ Toxin fs2 (NMR, 20 structures)
pdb|TOXIN|1TFS__ Toxin fs2 (NMR, 20 structures)

Length = 60

Score = 48 (23.2 bits)
Expect = 1.9e-07
Sum P(2) = 1.9e-07
Identities = 9/21 (42%)
Positives = 13/21 (61%)

Query:    18 KNICYKMFMVATPKLPVKRGC 38
             +N CYKMF+    +   +RGC
Subject:  19 ENTCYKMFIRTHREYISERGC 39
Score = 45 (21.7 bits)
Expect = 1.9e-07
Sum P(2) = 1.9e-07
Identities = 7/19 (36%)
Positives = 10/19 (52%)
Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CP +    +  CC  D+CN
Subject:  41 CPTAMWPYQTECCKGDRCN 59

Accession: pdb|NEUROTOXIN|1NOR__ Neurotoxin ii (NMR, 19 structures)
pdb|NEUROTOXIN|1NOR__ Neurotoxin ii (NMR, 19 structures)

Length = 61

Score = 58 (28.0 bits)
Expect = 2.8e-07
Sum P(2) = 2.8e-07
Identities = 10/19 (52%)
Positives = 11/19 (57%)

Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CPK    V   CC TD+CN
Subject:  42 CPKVKPGVNLNCCRTDRCN 60
Score = 35 (16.9 bits)
Expect = 2.8e-07
Sum P(2) = 2.8e-07
Identities = 7/23 (30%)
Positives = 12/23 (52%)
Query:    16 AGKNICYKMFMVATPKLPVKRGC 38
             +G+  CYK +        ++RGC
Subject:  18 SGETNCYKKWWSDHRGTIIERGC 40

Accession: pdb|NEUROTOXIN|1NTX__ Alpha-neurotoxin (NMR, 20 structures)
pdb|NEUROTOXIN|1NTX__ Alpha-neurotoxin (NMR, 20 structures)

Length = 60

Score = 55 (26.5 bits)
Expect = 9.2e-07
Sum P(2) = 9.2e-07
Identities = 10/19 (52%)
Positives = 11/19 (57%)

Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CPK    V   CC +DKCN
Subject:  41 CPKVKPGVGIHCCQSDKCN 59
Score = 36 (17.4 bits)
Expect = 9.2e-07
Sum P(2) = 9.2e-07
Identities = 7/21 (33%)
Positives = 11/21 (52%)
Query:    18 KNICYKMFMVATPKLPVKRGC 38
             +N CYK +        ++RGC
Subject:  19 ENSCYKKYWRDHRGTIIERGC 39

Accession: pdb|TOXIN|1KBA_A Kappa-bungarotoxin
pdb|TOXIN|1KBA_A Kappa-bungarotoxin

Length = 66

Score = 45 (21.7 bits)
Expect = 1.2e-05
Sum P(2) = 1.2e-05
Identities = 6/9 (66%)
Positives = 7/9 (77%)

Query:    52 VCCNTDKCN 60
             +CC TD CN
Subject:  57 LCCTTDNCN 65
Score = 44 (21.2 bits)
Expect = 1.2e-05
Sum P(2) = 1.2e-05
Identities = 6/11 (54%)
Positives = 10/11 (90%)
Query:    12 KTCPAGKNICY 22
             +TCP G++IC+
Subject:  12 QTCPNGQDICF 22
Score = 43 (20.8 bits)
Expect = 3.8e-05
Sum P(2) = 3.8e-05
Identities = 7/23 (30%)
Positives = 13/23 (56%)
Query:    34 VKRGCIDVCPKSSLLVRYVCCNT 56
             +++GC+  CP+     R + C T
Subject:  38 IEQGCVATCPQFRSNYRSLLCCT 60

Accession: pdb|TOXIN|1KBA_B Kappa-bungarotoxin
pdb|TOXIN|1KBA_B Kappa-bungarotoxin

Length = 66

Score = 45 (21.7 bits)
Expect = 1.2e-05
Sum P(2) = 1.2e-05
Identities = 6/9 (66%)
Positives = 7/9 (77%)

Query:    52 VCCNTDKCN 60
             +CC TD CN
Subject:  57 LCCTTDNCN 65
Score = 44 (21.2 bits)
Expect = 1.2e-05
Sum P(2) = 1.2e-05
Identities = 6/11 (54%)
Positives = 10/11 (90%)
Query:    12 KTCPAGKNICY 22
             +TCP G++IC+
Subject:  12 QTCPNGQDICF 22
Score = 43 (20.8 bits)
Expect = 3.8e-05
Sum P(2) = 3.8e-05
Identities = 7/23 (30%)
Positives = 13/23 (56%)
Query:    34 VKRGCIDVCPKSSLLVRYVCCNT 56
             +++GC+  CP+     R + C T
Subject:  38 IEQGCVATCPQFRSNYRSLLCCT 60

Accession: pdb|TOXIN|1NBT_A Bungarotoxin (neuronal) (NMR, 12 structures)
pdb|TOXIN|1NBT_A Bungarotoxin (neuronal) (NMR, 12 structures)

Length = 66

Score = 45 (21.7 bits)
Expect = 1.2e-05
Sum P(2) = 1.2e-05
Identities = 6/9 (66%)
Positives = 7/9 (77%)

Query:    52 VCCNTDKCN 60
             +CC TD CN
Subject:  57 LCCTTDNCN 65
Score = 44 (21.2 bits)
Expect = 1.2e-05
Sum P(2) = 1.2e-05
Identities = 6/11 (54%)
Positives = 10/11 (90%)
Query:    12 KTCPAGKNICY 22
             +TCP G++IC+
Subject:  12 QTCPNGQDICF 22
Score = 43 (20.8 bits)
Expect = 3.8e-05
Sum P(2) = 3.8e-05
Identities = 7/23 (30%)
Positives = 13/23 (56%)
Query:    34 VKRGCIDVCPKSSLLVRYVCCNT 56
             +++GC+  CP+     R + C T
Subject:  38 IEQGCVATCPQFRSNYRSLLCCT 60

Accession: pdb|TOXIN|1NBT_B Bungarotoxin (neuronal) (NMR, 12 structures)
pdb|TOXIN|1NBT_B Bungarotoxin (neuronal) (NMR, 12 structures)

Length = 66

Score = 45 (21.7 bits)
Expect = 1.2e-05
Sum P(2) = 1.2e-05
Identities = 6/9 (66%)
Positives = 7/9 (77%)

Query:    52 VCCNTDKCN 60
             +CC TD CN
Subject:  57 LCCTTDNCN 65
Score = 44 (21.2 bits)
Expect = 1.2e-05
Sum P(2) = 1.2e-05
Identities = 6/11 (54%)
Positives = 10/11 (90%)
Query:    12 KTCPAGKNICY 22
             +TCP G++IC+
Subject:  12 QTCPNGQDICF 22
Score = 43 (20.8 bits)
Expect = 3.8e-05
Sum P(2) = 3.8e-05
Identities = 7/23 (30%)
Positives = 13/23 (56%)
Query:    34 VKRGCIDVCPKSSLLVRYVCCNT 56
             +++GC+  CP+     R + C T
Subject:  38 IEQGCVATCPQFRSNYRSLLCCT 60

Accession: pdb|TOXIN|1NEA__ Toxin alpha (NMR, 8 structures)
pdb|TOXIN|1NEA__ Toxin alpha (NMR, 8 structures)

Length = 61

Score = 56 (27.0 bits)
Expect = 1.7e-05
Sum P(2) = 1.7e-05
Identities = 9/19 (47%)
Positives = 11/19 (57%)

Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CP     ++  CC TDKCN
Subject:  42 CPTVKPGIKLNCCTTDKCN 60
Score = 31 (15.0 bits)
Expect = 1.7e-05
Sum P(2) = 1.7e-05
Identities = 6/14 (42%)
Positives = 8/14 (57%)
Query:    12 KTCPAGKNICYKMF 25
             KTCP   N   K++
Subject:  15 KTCPGETNCYKKVW 28
Score = 31 (15.0 bits)
Expect = 1.7e-05
Sum P(2) = 1.7e-05
Identities = 7/22 (31%)
Positives = 10/22 (45%)
Query:    17 GKNICYKMFMVATPKLPVKRGC 38
             G+  CYK          ++RGC
Subject:  19 GETNCYKKVWRDHRGTIIERGC 40

Accession: pdb|SHORT NEUROTOXIN|1COD__ Cobrotoxin (NMR, average structure)
pdb|SHORT NEUROTOXIN|1COD__ Cobrotoxin (NMR, average structure)

Length = 62

Score = 52 (25.1 bits)
Expect = 2.1e-05
Sum P(2) = 2.1e-05
Identities = 8/19 (42%)
Positives = 10/19 (52%)

Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CP     +   CC TD+CN
Subject:  43 CPSVKNGIEINCCTTDRCN 61
Score = 35 (16.9 bits)
Expect = 2.1e-05
Sum P(2) = 2.1e-05
Identities = 8/25 (32%)
Positives = 10/25 (40%)
Query:    14 CPAGKNICYKMFMVATPKLPVKRGC 38
             C  G+  CYK           +RGC
Subject:  17 CSGGETNCYKKRWRDHRGYRTERGC 41

Accession: pdb|SHORT NEUROTOXIN|1COE__ Cobrotoxin (NMR, 11 structures)
pdb|SHORT NEUROTOXIN|1COE__ Cobrotoxin (NMR, 11 structures)

Length = 62

Score = 52 (25.1 bits)
Expect = 2.1e-05
Sum P(2) = 2.1e-05
Identities = 8/19 (42%)
Positives = 10/19 (52%)

Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CP     +   CC TD+CN
Subject:  43 CPSVKNGIEINCCTTDRCN 61
Score = 35 (16.9 bits)
Expect = 2.1e-05
Sum P(2) = 2.1e-05
Identities = 8/25 (32%)
Positives = 10/25 (40%)
Query:    14 CPAGKNICYKMFMVATPKLPVKRGC 38
             C  G+  CYK           +RGC
Subject:  17 CSGGETNCYKKRWRDHRGYRTERGC 41

Accession: pdb|TOXIN|5EBX__ Erabutoxin a
pdb|TOXIN|5EBX__ Erabutoxin a

Length = 62

Score = 45 (21.7 bits)
Expect = 2.1e-05
Sum P(2) = 2.1e-05
Identities = 10/31 (32%)
Positives = 14/31 (45%)

Query:     8 PLFYKTCPAGKNICYKMFMVATPKLPVKRGC 38
             P   KTC  G++ CY           ++RGC
Subject:  11 PQTTKTCSPGESSCYNKQWSDFRGTIIERGC 41
Score = 42 (20.3 bits)
Expect = 2.1e-05
Sum P(2) = 2.1e-05
Identities = 6/19 (31%)
Positives = 10/19 (52%)
Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CP     ++  CC ++ CN
Subject:  43 CPTVKPGIKLSCCESEVCN 61

Accession: pdb|TOXIN|1ERA__ Erabutoxin b (NMR, minimized average structure)
pdb|TOXIN|1ERA__ Erabutoxin b (NMR, minimized average structure)

Length = 62

Score = 44 (21.2 bits)
Expect = 3.7e-05
Sum P(2) = 3.7e-05
Identities = 10/31 (32%)
Positives = 14/31 (45%)

Query:     8 PLFYKTCPAGKNICYKMFMVATPKLPVKRGC 38
             P   KTC  G++ CY           ++RGC
Subject:  11 PQTTKTCSPGESSCYHKQWSDFRGTIIERGC 41
Score = 42 (20.3 bits)
Expect = 3.7e-05
Sum P(2) = 3.7e-05
Identities = 6/19 (31%)
Positives = 10/19 (52%)
Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CP     ++  CC ++ CN
Subject:  43 CPTVKPGIKLSCCESEVCN 61

Accession: pdb|TOXIN|1FRA__ Erabutoxin b (NMR, 14 structures)
pdb|TOXIN|1FRA__ Erabutoxin b (NMR, 14 structures)

Length = 62

Score = 44 (21.2 bits)
Expect = 3.7e-05
Sum P(2) = 3.7e-05
Identities = 10/31 (32%)
Positives = 14/31 (45%)

Query:     8 PLFYKTCPAGKNICYKMFMVATPKLPVKRGC 38
             P   KTC  G++ CY           ++RGC
Subject:  11 PQTTKTCSPGESSCYHKQWSDFRGTIIERGC 41
Score = 42 (20.3 bits)
Expect = 3.7e-05
Sum P(2) = 3.7e-05
Identities = 6/19 (31%)
Positives = 10/19 (52%)
Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CP     ++  CC ++ CN
Subject:  43 CPTVKPGIKLSCCESEVCN 61

Accession: pdb|NEUROTOXIN (POST-SYNAPTIC)|1NXB__ Neurotoxin b (probably identical to
pdb|NEUROTOXIN (POST-SYNAPTIC)|1NXB__ Neurotoxin b (probably identical to erab

Length = 62

Score = 44 (21.2 bits)
Expect = 3.7e-05
Sum P(2) = 3.7e-05
Identities = 10/31 (32%)
Positives = 14/31 (45%)

Query:     8 PLFYKTCPAGKNICYKMFMVATPKLPVKRGC 38
             P   KTC  G++ CY           ++RGC
Subject:  11 PQTTKTCSPGESSCYHKQWSDFRGTIIERGC 41
Score = 42 (20.3 bits)
Expect = 3.7e-05
Sum P(2) = 3.7e-05
Identities = 6/19 (31%)
Positives = 10/19 (52%)
Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CP     ++  CC ++ CN
Subject:  43 CPTVKPGIKLSCCESEVCN 61

Accession: pdb|TOXIN|3EBX__ Erabutoxin b
pdb|TOXIN|3EBX__ Erabutoxin b

Length = 62

Score = 44 (21.2 bits)
Expect = 3.7e-05
Sum P(2) = 3.7e-05
Identities = 10/31 (32%)
Positives = 14/31 (45%)

Query:     8 PLFYKTCPAGKNICYKMFMVATPKLPVKRGC 38
             P   KTC  G++ CY           ++RGC
Subject:  11 PQTTKTCSPGESSCYHKQWSDFRGTIIERGC 41
Score = 42 (20.3 bits)
Expect = 3.7e-05
Sum P(2) = 3.7e-05
Identities = 6/19 (31%)
Positives = 10/19 (52%)
Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CP     ++  CC ++ CN
Subject:  43 CPTVKPGIKLSCCESEVCN 61

Accession: pdb|TOXIN|6EBX_A Erabutoxin b (dimeric form) crystallized from kscn
pdb|TOXIN|6EBX_A Erabutoxin b (dimeric form) crystallized from kscn

Length = 62

Score = 44 (21.2 bits)
Expect = 3.7e-05
Sum P(2) = 3.7e-05
Identities = 10/31 (32%)
Positives = 14/31 (45%)

Query:     8 PLFYKTCPAGKNICYKMFMVATPKLPVKRGC 38
             P   KTC  G++ CY           ++RGC
Subject:  11 PQTTKTCSPGESSCYHKQWSDFRGTIIERGC 41
Score = 42 (20.3 bits)
Expect = 3.7e-05
Sum P(2) = 3.7e-05
Identities = 6/19 (31%)
Positives = 10/19 (52%)
Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CP     ++  CC ++ CN
Subject:  43 CPTVKPGIKLSCCESEVCN 61

Accession: pdb|TOXIN|6EBX_B Erabutoxin b (dimeric form) crystallized from kscn
pdb|TOXIN|6EBX_B Erabutoxin b (dimeric form) crystallized from kscn

Length = 62

Score = 44 (21.2 bits)
Expect = 3.7e-05
Sum P(2) = 3.7e-05
Identities = 10/31 (32%)
Positives = 14/31 (45%)

Query:     8 PLFYKTCPAGKNICYKMFMVATPKLPVKRGC 38
             P   KTC  G++ CY           ++RGC
Subject:  11 PQTTKTCSPGESSCYHKQWSDFRGTIIERGC 41
Score = 42 (20.3 bits)
Expect = 3.7e-05
Sum P(2) = 3.7e-05
Identities = 6/19 (31%)
Positives = 10/19 (52%)
Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CP     ++  CC ++ CN
Subject:  43 CPTVKPGIKLSCCESEVCN 61

Accession: pdb|TOXIN|1FAS__ Fasciculin 1
pdb|TOXIN|1FAS__ Fasciculin 1

Length = 61

Score = 50 (24.1 bits)
Expect = 9.4e-05
Sum P(2) = 9.4e-05
Identities = 9/22 (40%)
Positives = 13/22 (59%)

Query:    17 GKNICYKMFMVATPKLPVKRGC 38
             G+N CY+      PK+ + RGC
Subject:  18 GENSCYRKSRRHPPKMVLGRGC 39
Score = 34 (16.4 bits)
Expect = 9.4e-05
Sum P(2) = 9.4e-05
Identities = 5/8 (62%)
Positives = 6/8 (75%)
Query:    53 CCNTDKCN 60
             C + DKCN
Subject:  53 CTSPDKCN 60
Score = 27 (13.0 bits)
Expect = 0.0033
Sum P(2) = 0.0033
Identities = 4/15 (26%)
Positives = 6/15 (40%)
Query:    42 CPKSSLLVRYVCCNT 56
             CP     +   CC +
Subject:  41 CPPGDDYLEVKCCTS 55

Accession: pdb|SNAKE TOXIN|1FSC__ Fasciculin 2 (synchrotron x-ray diffraction)
pdb|SNAKE TOXIN|1FSC__ Fasciculin 2 (synchrotron x-ray diffraction)

Length = 61

Score = 50 (24.1 bits)
Expect = 9.4e-05
Sum P(2) = 9.4e-05
Identities = 9/22 (40%)
Positives = 13/22 (59%)

Query:    17 GKNICYKMFMVATPKLPVKRGC 38
             G+N CY+      PK+ + RGC
Subject:  18 GENSCYRKSRRHPPKMVLGRGC 39
Score = 34 (16.4 bits)
Expect = 9.4e-05
Sum P(2) = 9.4e-05
Identities = 5/8 (62%)
Positives = 6/8 (75%)
Query:    53 CCNTDKCN 60
             C + DKCN
Subject:  53 CTSPDKCN 60

Accession: pdb|COMPLEX (SERINE ESTERASE/TOXIN)|1FSS_B (E.C. 3.1.1.7), fasciculin ii
pdb|COMPLEX (SERINE ESTERASE/TOXIN)|1FSS_B (E.C. 3.1.1.7), fasciculin ii

Length = 61

Score = 50 (24.1 bits)
Expect = 9.4e-05
Sum P(2) = 9.4e-05
Identities = 9/22 (40%)
Positives = 13/22 (59%)

Query:    17 GKNICYKMFMVATPKLPVKRGC 38
             G+N CY+      PK+ + RGC
Subject:  18 GENSCYRKSRRHPPKMVLGRGC 39
Score = 34 (16.4 bits)
Expect = 9.4e-05
Sum P(2) = 9.4e-05
Identities = 5/8 (62%)
Positives = 6/8 (75%)
Query:    53 CCNTDKCN 60
             C + DKCN
Subject:  53 CTSPDKCN 60

Accession: pdb|COMPLEX (HYDROLASE/TOXIN)|1MAH_F (E.C. 3.1.1.7), (toxin f-vii, fas2,
pdb|COMPLEX (HYDROLASE/TOXIN)|1MAH_F (E.C. 3.1.1.7), (toxin f-vii, fas2, toxin

Length = 61

Score = 50 (24.1 bits)
Expect = 9.4e-05
Sum P(2) = 9.4e-05
Identities = 9/22 (40%)
Positives = 13/22 (59%)

Query:    17 GKNICYKMFMVATPKLPVKRGC 38
             G+N CY+      PK+ + RGC
Subject:  18 GENSCYRKSRRHPPKMVLGRGC 39
Score = 34 (16.4 bits)
Expect = 9.4e-05
Sum P(2) = 9.4e-05
Identities = 5/8 (62%)
Positives = 6/8 (75%)
Query:    53 CCNTDKCN 60
             C + DKCN
Subject:  53 CTSPDKCN 60

Accession: pdb|CELL ADHESION PROTEIN|1DRS__ Dendroaspin (mambin, s5c1SH04) (NMR, 39
pdb|CELL ADHESION PROTEIN|1DRS__ Dendroaspin (mambin, s5c1SH04) (NMR, 39 STRUC

Length = 59

Score = 45 (21.7 bits)
Expect = 0.00095
Sum P(2) = 0.00095
Identities = 6/8 (75%)
Positives = 7/8 (87%)

Query:    53 CCNTDKCN 60
             CC +DKCN
Subject:  51 CCESDKCN 58
Score = 34 (16.4 bits)
Expect = 0.00095
Sum P(2) = 0.00095
Identities = 6/20 (30%)
Positives = 10/20 (50%)
Query:    34 VKRGCIDVCPKSSLLVRYVC 53
             ++RGC    P+  +   Y C
Subject:  33 IRRGCGCFTPRGDMPGPYCC 52

Accession: pdb|TOXIN|1CTX__ Alpha cobratoxin
pdb|TOXIN|1CTX__ Alpha cobratoxin

Length = 71

Score = 65 (31.4 bits)
Expect = 0.0012
P = 0.0012
Identities = 12/27 (44%)
Positives = 13/27 (48%)

Query:    34 VKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             V  GC   CP     V   CC+TD CN
Subject:  37 VDLGCAATCPTVKTGVDIQCCSTDNCN 63

Accession: pdb|NEUROTOXIN|2CTX__ Alpha-cobratoxin
pdb|NEUROTOXIN|2CTX__ Alpha-cobratoxin

Length = 71

Score = 65 (31.4 bits)
Expect = 0.0012
P = 0.0012
Identities = 12/27 (44%)
Positives = 13/27 (48%)

Query:    34 VKRGCIDVCPKSSLLVRYVCCNTDKCN 60
             V  GC   CP     V   CC+TD CN
Subject:  37 VDLGCAATCPTVKTGVDIQCCSTDNCN 63

Accession: pdb|COMPLEX (HORMONE TRANSPORT/HORMONE)|1NPO_A (ot)
pdb|COMPLEX (HORMONE TRANSPORT/HORMONE)|1NPO_A (ot)

Length = 81

Score = 37 (17.9 bits)
Expect = 2.5
Sum P(2) = 0.92
Identities = 4/8 (50%)
Positives = 6/8 (75%)

Query:    52 VCCNTDKC 59
             +CCN + C
Subject:  68 ICCNDESC 75
Score = 27 (13.0 bits)
Expect = 2.5
Sum P(2) = 0.92
Identities = 4/8 (50%)
Positives = 5/8 (62%)
Query:    15 PAGKNICY 22
             P GK  C+
Subject:  11 PGGKGRCF 18

Accession: pdb|DNA-BINDING PROTEIN|1SFE__ (E.C. 2.1.1.63), fragment
pdb|DNA-BINDING PROTEIN|1SFE__ (E.C. 2.1.1.63), fragment

Length = 165

Score = 46 (22.2 bits)
Expect = 2.7
P = 0.93
Identities = 10/42 (23%)
Positives = 16/42 (38%)

Query:    12 KTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVC 53
             +T P G+ + Y+    A  K    R     C  + L +   C
Subject:  94 RTIPCGETVSYQQLANAIGKPKAVRAVASACAANKLAIVIPC 135

Accession: pdb|HORMONE|1BN2_1 Bovine neurophysin II complex with p-iodo-phe-tyr amide
pdb|HORMONE|1BN2_1 Bovine neurophysin II complex with p-iodo-phe-tyr amide

Length = 86

Score = 37 (17.9 bits)
Expect = 2.9
Sum P(2) = 0.94
Identities = 4/8 (50%)
Positives = 6/8 (75%)

Query:    52 VCCNTDKC 59
             +CCN + C
Subject:  72 ICCNDESC 79
Score = 27 (13.0 bits)
Expect = 2.9
Sum P(2) = 0.94
Identities = 4/8 (50%)
Positives = 5/8 (62%)
Query:    15 PAGKNICY 22
             P GK  C+
Subject:  15 PGGKGRCF 22

Accession: pdb|HORMONE|1BN2_2 Bovine neurophysin II complex with p-iodo-phe-tyr amide
pdb|HORMONE|1BN2_2 Bovine neurophysin II complex with p-iodo-phe-tyr amide

Length = 86

Score = 37 (17.9 bits)
Expect = 2.9
Sum P(2) = 0.94
Identities = 4/8 (50%)
Positives = 6/8 (75%)

Query:    52 VCCNTDKC 59
             +CCN + C
Subject:  72 ICCNDESC 79
Score = 27 (13.0 bits)
Expect = 2.9
Sum P(2) = 0.94
Identities = 4/8 (50%)
Positives = 5/8 (62%)
Query:    15 PAGKNICY 22
             P GK  C+
Subject:  15 PGGKGRCF 22

Accession: pdb|HORMONE|1BN2_3 Bovine neurophysin II complex with p-iodo-phe-tyr amide
pdb|HORMONE|1BN2_3 Bovine neurophysin II complex with p-iodo-phe-tyr amide

Length = 86

Score = 37 (17.9 bits)
Expect = 2.9
Sum P(2) = 0.94
Identities = 4/8 (50%)
Positives = 6/8 (75%)

Query:    52 VCCNTDKC 59
             +CCN + C
Subject:  72 ICCNDESC 79
Score = 27 (13.0 bits)
Expect = 2.9
Sum P(2) = 0.94
Identities = 4/8 (50%)
Positives = 5/8 (62%)
Query:    15 PAGKNICY 22
             P GK  C+
Subject:  15 PGGKGRCF 22

Accession: pdb|HORMONE|1BN2_4 Bovine neurophysin II complex with p-iodo-phe-tyr amide
pdb|HORMONE|1BN2_4 Bovine neurophysin II complex with p-iodo-phe-tyr amide

Length = 86

Score = 37 (17.9 bits)
Expect = 2.9
Sum P(2) = 0.94
Identities = 4/8 (50%)
Positives = 6/8 (75%)

Query:    52 VCCNTDKC 59
             +CCN + C
Subject:  72 ICCNDESC 79
Score = 27 (13.0 bits)
Expect = 2.9
Sum P(2) = 0.94
Identities = 4/8 (50%)
Positives = 5/8 (62%)
Query:    15 PAGKNICY 22
             P GK  C+
Subject:  15 PGGKGRCF 22

Accession: pdb|SIGNAL TRANSDUCTION PROTEIN|1TBI__ (E.C. 2.7.1.37), (humalk-5, alk-5)
pdb|SIGNAL TRANSDUCTION PROTEIN|1TBI__ (E.C. 2.7.1.37), (humalk-5, alk-5)

Length = 81

Score = 44 (21.2 bits)
Expect = 4.3
P = 0.99
Identities = 7/17 (41%)
Positives = 9/17 (52%)

Query:    44 KSSLLVRYVCCNTDKCN 60
             K+  +    CCN D CN
Subject:  58 KTGSVTTTYCCNQDHCN 74

Accession: pdb|CARBOXYPEPTIDASE|1IVY_B (E.C. 3.4.16.5), biological_unit
pdb|CARBOXYPEPTIDASE|1IVY_B (E.C. 3.4.16.5), biological_unit

Length = 450

Score = 39 (18.8 bits)
Expect = 6.6
Sum P(2) = 1.0
Identities = 5/8 (62%)
Positives = 7/8 (87%)

Query:    53 CCNTDKCN 60
             CC+ +KCN
Subject: 212 CCSQNKCN 219
Score = 29 (14.0 bits)
Expect = 6.6
Sum P(2) = 1.0
Identities = 6/19 (31%)
Positives = 8/19 (42%)
Query:     4 NKLVPLFYKTCPAGKNICY 22
             N +  + Y   PAG    Y
Subject:  90 NLIANVLYLESPAGVGFSY 108

Accession: pdb|CARBOXYPEPTIDASE|1IVY_A (E.C. 3.4.16.5), biological_unit
pdb|CARBOXYPEPTIDASE|1IVY_A (E.C. 3.4.16.5), biological_unit

Length = 452

Score = 39 (18.8 bits)
Expect = 6.6
Sum P(2) = 1.0
Identities = 5/8 (62%)
Positives = 7/8 (87%)

Query:    53 CCNTDKCN 60
             CC+ +KCN
Subject: 212 CCSQNKCN 219
Score = 29 (14.0 bits)
Expect = 6.6
Sum P(2) = 1.0
Identities = 6/19 (31%)
Positives = 8/19 (42%)
Query:     4 NKLVPLFYKTCPAGKNICY 22
             N +  + Y   PAG    Y
Subject:  90 NLIANVLYLESPAGVGFSY 108

Accession: pdb|COMPLEMENT FACTOR|1ERG__ Human complement regulatory protein cd59
pdb|COMPLEMENT FACTOR|1ERG__ Human complement regulatory protein cd59 (extrace

Length = 70

Score = 42 (20.3 bits)
Expect = 8.2
P = 1.0
Identities = 6/10 (60%)
Positives = 6/10 (60%)

Query:    51 YVCCNTDKCN 60
             Y CC  D CN
Subject:  61 YYCCKKDLCN 70

Accession: pdb|COMPLEMENT FACTOR|1ERH__ Human complement regulatory protein cd59
pdb|COMPLEMENT FACTOR|1ERH__ Human complement regulatory protein cd59 (extrace

Length = 70

Score = 42 (20.3 bits)
Expect = 8.2
P = 1.0
Identities = 6/10 (60%)
Positives = 6/10 (60%)

Query:    51 YVCCNTDKCN 60
             Y CC  D CN
Subject:  61 YYCCKKDLCN 70

Accession: pdb|COMPLEMENT REGULATORY PROTEIN|1CDQ__ Cd59 (NMR, 20 structures)
pdb|COMPLEMENT REGULATORY PROTEIN|1CDQ__ Cd59 (NMR, 20 structures)

Length = 77

Score = 42 (20.3 bits)
Expect = 8.7
P = 1.0
Identities = 6/10 (60%)
Positives = 6/10 (60%)

Query:    51 YVCCNTDKCN 60
             Y CC  D CN
Subject:  61 YYCCKKDLCN 70

Accession: pdb|COMPLEMENT REGULATORY PROTEIN|1CDR__ Cd59 complexed with
pdb|COMPLEMENT REGULATORY PROTEIN|1CDR__ Cd59 complexed with glcnac-beta-1,4-g

Length = 77

Score = 42 (20.3 bits)
Expect = 8.7
P = 1.0
Identities = 6/10 (60%)
Positives = 6/10 (60%)

Query:    51 YVCCNTDKCN 60
             Y CC  D CN
Subject:  61 YYCCKKDLCN 70

Accession: pdb|COMPLEMENT REGULATORY PROTEIN|1CDS__ Cd59 complexed with
pdb|COMPLEMENT REGULATORY PROTEIN|1CDS__ Cd59 complexed with glcnac-beta-1,4-(

Length = 77

Score = 42 (20.3 bits)
Expect = 8.7
P = 1.0
Identities = 6/10 (60%)
Positives = 6/10 (60%)

Query:    51 YVCCNTDKCN 60
             Y CC  D CN
Subject:  61 YYCCKKDLCN 70

Accession: pdb|MATRIX PROTEIN|1EMN__ fragment
pdb|MATRIX PROTEIN|1EMN__ fragment

Length = 82

Score = 42 (20.3 bits)
Expect = 9.0
P = 1.0
Identities = 7/19 (36%)
Positives = 11/19 (57%)

Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CP   +L    C +TD+C+
Subject:  30 CPFGYILAGNECVDTDECS 48

Accession: pdb|MATRIX PROTEIN|1EMO__ fragment
pdb|MATRIX PROTEIN|1EMO__ fragment

Length = 82

Score = 42 (20.3 bits)
Expect = 9.0
P = 1.0
Identities = 7/19 (36%)
Positives = 11/19 (57%)

Query:    42 CPKSSLLVRYVCCNTDKCN 60
             CP   +L    C +TD+C+
Subject:  30 CPFGYILAGNECVDTDECS 48

Accession: pdb|POTASSIUM CHANNEL INHIBITOR|1ROO__ (shktx)
pdb|POTASSIUM CHANNEL INHIBITOR|1ROO__ (shktx)

Length = 35

Score = 39 (18.8 bits)
Expect = 9.9
P = 1.0
Identities = 7/10 (70%)
Positives = 7/10 (70%)

Query:    36 RGCIDVCPKS 45
             R CID  PKS
Subject:   1 RSCIDTIPKS 10

Parameters:
  B=250
  V=500
  -ctxfactor=1.00
  E=10
  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.335   0.145   0.496    same    same    same
  Query
  Frame  MatID  Length  Eff.Length   E    S W   T  X     E2  S2
   +0      0       60        60      10. 43 3  11 21    0.20 27
Statistics:
  Query          Expected         Observed           HSPs       HSPs
  Frame  MatID  High Score       High Score       Reportable  Reported
   +0      0    47 (22.7 bits)  329 (158.8 bits)      105        105
  Query         Neighborhd  Word      Excluded    Failed   Successful  Overlaps
  Frame  MatID   Words      Hits        Hits    Extensions Extensions  Excluded
   +0      0      1960      230393       50483      178290     1620         0
  Database:  pdb.db.prot
    Release date:  unknown
    Posted date:  11:35 PM CDT Aug 21, 1997
  # of letters in database:  1,888,416
  # of sequences in database:  9717
  # of database sequences satisfying E:  62
  No. of states in DFA:  462 (46 KB)
  Total size of DFA:  66 KB (128 KB)
  Time to generate neighborhood:  0.01u 0.00s 0.01t  Real: 00:00:01
  Time to search database:  0.44u 0.03s 0.47t  Real: 00:00:00
  Total cpu time:  0.48u 0.11s 0.59t  Real: 00:00:01


Copyright (C) 1997, Board of Trustees of the University of Illinois.