Your query has been submitted, please wait for results

BLASTX 1.4.11 [24-Nov-97] [Build 24-Nov-97]

Reference:  Gish, Warren and David J. States (1993).  Identification of
protein coding regions by database similarity search.  Nat. Genet. 3:266-72.
Altschul, Stephen F., Warren Gish, Webb Miller, Eugene W. Myers, and David J.
Lipman (1990).  Basic local alignment search tool.  J. Mol. Biol. 215:403-10.

Notice:  statistical significance is estimated under the assumption that
the equivalent of one entire reading frame in the query sequence codes for
protein and that significant alignments will involve only coding reading
frames.

Query=  tmpseq_1
        (605 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  Non-redundant GenBank CDS
           translations+PDB+SwissProt+SPupdate+PIR
           277,055 sequences; 82,859,678 total letters.
Searching..................................................done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

sp|Q42952|NLT1_TOBAC NONSPECIFIC LIPID-TRANSFER PROTEI... +2   590  1.2e-72   1
gi|1519357           (U66466) lipid transfer protein 2... +2   458  1.9e-54   1
sp|Q03461|NLTP_TOBAC NONSPECIFIC LIPID-TRANSFER PROTEI... +2   453  9.3e-54   1
gi|1519355           (U66465) lipid transfer protein 1... +2   447  6.3e-53   1
sp|P27056|NLT2_LYCES NONSPECIFIC LIPID-TRANSFER PROTEI... +2   445  1.2e-52   1
sp|P93224|NLT1_LYCES NONSPECIFIC LIPID-TRANSFER PROTEI... +2   443  2.2e-52   1
sp|Q43017|NLT1_PRUDU NONSPECIFIC LIPID-TRANSFER PROTEI... +2   205  5.1e-35   2
sp|P10976|NLTP_SPIOL NONSPECIFIC LIPID-TRANSFER PROTEI... +2   306  1.7e-33   1
sp|P19656|NLTP_MAIZE NONSPECIFIC LIPID-TRANSFER PROTEI... +2   239  4.3e-33   2
sp|Q42999|NLT3_ORYSA NONSPECIFIC LIPID-TRANSFER PROTEI... +2   293  1.1e-31   1
prf||1906368A        le16 gene [Lycopersicon esculentum]  +2   231  8.8e-31   2
gi|1498597           (U66105) phospholipid transfer pr... +2   219  1.7e-30   2
sp|Q43194|NLT2_SORVU NONSPECIFIC LIPID-TRANSFER PROTEI... +2   235  1.7e-30   2
pir||S00060          phospholipid transfer protein - s... +2   283  2.6e-30   1
pdb|1MZM|             Maize Nonspecific Lipid Transfer... +2   239  3.6e-30   2
sp|Q42616|NLT3_BRANA NONSPECIFIC LIPID-TRANSFER PROTEI... +2   209  5.6e-30   3
pir||JH0379          phospholipid transfer protein 6B6... +2   246  5.6e-30   2
sp|Q42614|NLT1_BRANA NONSPECIFIC LIPID-TRANSFER PROTEI... +2   201  1.0e-29   3
sp|Q42642|NLTB_BRAOL NONSPECIFIC LIPID-TRANSFER PROTEI... +2   198  2.6e-29   3
sp|Q42762|NLT1_GOSHI NONSPECIFIC LIPID-TRANSFER PROTEI... +2   228  2.7e-29   2
sp|Q43129|NLT2_GOSHI NONSPECIFIC LIPID-TRANSFER PROTEI... +2   228  2.8e-29   2
sp|Q42615|NLT2_BRANA NONSPECIFIC LIPID-TRANSFER PROTEI... +2   198  6.7e-29   3
sp|P27631|NLTP_DAUCA NONSPECIFIC LIPID-TRANSFER PROTEI... +2   223  3.5e-28   2
sp|Q43193|NLT1_SORVU NONSPECIFIC LIPID-TRANSFER PROTEI... +2   224  8.7e-28   2
sp|Q43304|NLTD_BRAOL NONSPECIFIC LIPID-TRANSFER PROTEI... +2   209  2.1e-27   3
sp|P23096|NLT1_ORYSA NONSPECIFIC LIPID-TRANSFER PROTEI... +2   214  2.2e-27   2
pir||S49198          Cw-19 peptide, non specific lipid... +2   210  3.7e-26   2
bbs|163497           acyl-binding/lipid-transfer prote... +2   198  5.9e-26   2
gi|19039             (X60292) LTP 1 [Hordeum vulgare]     +2   208  7.6e-26   2
sp|P07597|NLT1_HORVU NONSPECIFIC LIPID-TRANSFER PROTEI... +2   205  9.4e-26   2
gnl|PID|e234051      (X96979) lipid transfer protein 7... +2   198  1.4e-25   2
pir||EPRZ            phospholipid transfer protein hom... +2   213  1.5e-25   2
gi|2407277           (AF017361) lipid transfer protein... +2   201  1.7e-25   2
gi|1209260           (L31938) similar to lipid transfe... +2   160  3.4e-25   2
pir||S45370          non-specific lipid transfer prote... +2   112  3.7e-25   3
gi|899224            (X60318) pid:e41290 [Brassica nap... +2   160  4.6e-25   2
bbs|163499           acyl-binding/lipid-transfer prote... +2   209  1.9e-24   2
sp|Q43019|NLT3_PRUDU NONSPECIFIC LIPID-TRANSFER PROTEI... +2   120  2.1e-24   4
pir||S28871          lipid transfer protein Cw(18) - b... +2   112  2.2e-24   3
prf||2115353B        lipid transfer protein [Hordeum v... +2   114  2.3e-24   3
gi|1050918           (X92648) lipid transfer protein [... +2   236  7.8e-24   1
pdb|1LIP|             Barley Lipid Transfer Protein (N... +2   205  3.0e-23   2
bbs|163498           acyl-binding/lipid-transfer prote... +2   202  3.2e-23   2
gi|2407275           (AF017360) lipid transfer protein... +2   176  3.7e-23   3
sp|Q42978|NLT2_ORYSA NONSPECIFIC LIPID-TRANSFER PROTEI... +2   231  3.8e-23   1
gnl|PID|e1184834     (AJ002958) lipid transfer protein... +2   221  4.9e-23   2
gi|2407273           (AF017359) lipid transfer protein... +2   229  7.2e-23   1
sp|Q42976|NLT4_ORYSA NONSPECIFIC LIPID-TRANSFER PROTEI... +2   187  1.3e-22   2
sp|Q43748|NLTP_BETVU NONSPECIFIC LIPID-TRANSFER PROTEI... +2   227  1.4e-22   1
sp|P24296|NLTA_WHEAT NONSPECIFIC LIPID-TRANSFER PROTEI... +2   193  1.6e-22   2
bbs|164063           basic protein 1A, WBP1A=lipid tra... +2   198  2.1e-22   2
bbs|164065           basic protein 1B, WBP1B=lipid tra... +2   197  2.9e-22   2
pir||S45635          lipid-transfer protein - Maize       +2   179  5.4e-22   2
gi|2407271           (AF017358) lipid transfer protein... +2   221  9.2e-22   1
gi|2335124           (U64874) lipid transfer protein [... +2   191  2.2e-21   2
pir||S33460          lipid transfer protein - sorghum ... +2   169  3.0e-21   2
pir||S21757          phospholipid transfer protein - w... +2   193  1.1e-20   2
sp|Q42589|NLT1_ARATH NONSPECIFIC LIPID-TRANSFER PROTEI... +2   122  5.0e-20   3
gi|2347088           (U72765) non-specific lipid trans... +2   208  5.7e-20   1
sp|P80450|NLTP_AMACA NONSPECIFIC LIPID-TRANSFER PROTEI... +2   165  2.8e-19   2
sp|Q39794|NLTP_GERHY NONSPECIFIC LIPID-TRANSFER PROTEI... +2   190  1.7e-17   1
sp|P23802|NLTP_ELECO NONSPECIFIC LIPID-TRANSFER PROTEI... +2   132  5.1e-16   2
pir||S45371          non-specific lipid transfer prote... +2   126  3.5e-15   2
pir||S28872          lipid transfer protein Cw(21) - b... +2   126  5.5e-15   2
prf||2115353A        lipid transfer protein [Hordeum v... +2   125  6.6e-15   2
gi|1045201           (Z66529) lipid transfer protein [... +2   126  8.9e-15   2
sp|Q42842|NLT4_HORVU NONSPECIFIC LIPID-TRANSFER PROTEI... +2   126  8.9e-15   2
gi|500845            (L33906) lipid transfer protein [... +2   144  2.4e-14   2
gi|642017            (U18127) phospholipid transfer pr... +2   128  4.2e-14   2
sp|P10973|NLTA_RICCO NONSPECIFIC LIPID-TRANSFER PROTEI... +2   140  7.0e-14   2
gi|587446            (Z37115) lipid transfer protein p... +2   126  7.9e-14   2
gi|16997             (Z17787) non-specific lipid-trans... +2    87  3.6e-13   3
sp|Q41073|NLTP_PINTA NONSPECIFIC LIPID-TRANSFER PROTEI... +2    80  4.6e-12   4
sp|P10974|NLTB_RICCO NONSPECIFIC LIPID-TRANSFER PROTEI... +2   135  7.4e-12   2
gi|17363             (Z18168) nonspecific lipid-transf... +2   111  3.7e-10   2
gi|537639            (U14168) lipid transfer protein [... +2   102  3.1e-09   2
gi|537637            (U14167) lipid transfer protein [... +2   100  3.2e-09   2
gnl|PID|e265485      (X95866) P8 protein [Parietaria j... +2   111  8.6e-09   2
gnl|PID|e334216      (Y14560) non-specific lipid trans... +2    84  1.2e-08   2
sp|Q42641|NLTA_BRAOL NONSPECIFIC LIPID-TRANSFER PROTEI... +2   101  1.5e-08   2
sp|P55958|NLT2_PARJU PROBABLE NONSPECIFIC LIPID-TRANSF... +2   103  1.0e-07   2
gi|16972             (Z17770) non-specific lipid-trans... +2   117  2.0e-07   1
gi|1916292           (U89793) allergen Amb a VI [Ambro... +2   117  2.0e-07   1
gi|2507619           (U90342) PrLTP1 [Pinus radiata]      +2    85  3.1e-06   2
sp|P29420|NLTP_RAPSA SEED NONSPECIFIC LIPID TRANSFER P... +2    85  1.8e-05   2
pir||S01796          nonspecific lipid transfer protei... +2    78  2.9e-05   3
sp|P25307|BLT4_HORVU BLT4 PROTEIN PRECURSOR /pir||S179... +2    97  0.00012   1
sp|Q40905|NLTQ_PARJU PROBABLE NONSPECIFIC LIPID-TRANSF... +2    82  0.00012   2
gi|169711            (M86354) lipid transfer protein [... +2    78  0.00027   2
sp|P10975|NLTC_RICCO NONSPECIFIC LIPID-TRANSFER PROTEI... +2    78  0.00027   2
gnl|PID|e265440      (X95867) P9 protein [Parietaria j... +2    80  0.00029   2
gnl|PID|e276374      (X96715) lipid transfer protein [... +2    73  0.00032   2
sp|Q43119|NLTD_RICCO NONSPECIFIC LIPID-TRANSFER PROTEI... +2    77  0.00036   2
sp|P80273|NLT3_VITSX NONSPECIFIC LIPID-TRANSFER PROTEI... +2    76  0.0018    2
gi|17491             (Z18392) Nonspecific lipid transf... +2    83  0.0098    1
gnl|PID|e276012      (Y08779) Men-7 [Silene latifolia]    +2    70  0.010     3
sp|P43217|NLTP_PARJU PROBABLE NONSPECIFIC LIPID-TRANSF... +2    82  0.013     1
pir||S41944          gene PmaI protein - Parietaria ju... +2    82  0.013     1
sp|P26913|NLTB_WHEAT PROBABLE NONSPECIFIC LIPID-TRANSF... +2    60  0.021     2
sp|P80275|NLT1_VITSX NONSPECIFIC LIPID-TRANSFER PROTEI... +2    80  0.025     1

 

sp|Q42952|NLT1_TOBAC NONSPECIFIC LIPID-TRANSFER PROTEIN 1 PRECURSOR
            (LTP 1) pir||S22168 lipid transfer protein - common tobacco
            gi|19883 (X62395) lipid transferase [Nicotiana tabacum]
            Length = 114

  Plus Strand HSPs:

 Score = 590 (270.3 bits), Expect = 1.2e-72, P = 1.2e-72
 Identities = 112/112 (100%), Positives = 112/112 (100%), Frame = +2

Query:   170 MEIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNS 349
             MEIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNS
Sbjct:     1 MEIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNS 60

Query:   350 ARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSK 505
             ARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSK
Sbjct:    61 ARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSK 112

 

gi|1519357 (U66466) lipid transfer protein 2 [Lycopersicon pennellii]
            Length = 114

  Plus Strand HSPs:

 Score = 458 (209.8 bits), Expect = 1.9e-54, P = 1.9e-54
 Identities = 85/112 (75%), Positives = 94/112 (83%), Frame = +2

Query:   170 MEIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNS 349
             ME+  KIACFV+LCMVV AP AEA+TCGQVTS LAPCL YL N GPLG CCGGVK L+  
Sbjct:     1 MEMVNKIACFVLLCMVVVAPHAEALTCGQVTSTLAPCLPYLMNRGPLGGCCGGVKGLLGQ 60

Query:   350 ARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSK 505
             A+TT DRQ ACTCLKSAA + +G++LGKAA LPSTC VNIPYKISPSTDCSK
Sbjct:    61 AQTTVDRQTACTCLKSAASSFTGLDLGKAASLPSTCSVNIPYKISPSTDCSK 112

 

sp|Q03461|NLTP_TOBAC NONSPECIFIC LIPID-TRANSFER PROTEIN PRECURSOR (LTP)
            pir||S29227 lipid transfer protein - common tobacco
            gnl|PID|d1003550 (D13952) lipid transfer protein [Nicotiana tabacum]
            Length = 114

  Plus Strand HSPs:

 Score = 453 (207.5 bits), Expect = 9.3e-54, P = 9.3e-54
 Identities = 83/112 (74%), Positives = 94/112 (83%), Frame = +2

Query:   170 MEIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNS 349
             ME+ GKIACFVVLCMVV AP AEA++CGQV S LAPCL YL+  GPLG CCGGVK L+ +
Sbjct:     1 MEMVGKIACFVVLCMVVVAPHAEALSCGQVQSGLAPCLPYLQGRGPLGSCCGGVKGLLGA 60

Query:   350 ARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSK 505
             A++  DR+ ACTCLKSAA AI GI++GKAAGLP  CGVNIPYKISPSTDCSK
Sbjct:    61 AKSLSDRKTACTCLKSAANAIKGIDMGKAAGLPGACGVNIPYKISPSTDCSK 112

 

gi|1519355 (U66465) lipid transfer protein 1 [Lycopersicon pennellii]
            Length = 114

  Plus Strand HSPs:

 Score = 447 (204.8 bits), Expect = 6.3e-53, P = 6.3e-53
 Identities = 83/111 (74%), Positives = 93/111 (83%), Frame = +2

Query:   170 MEIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNS 349
             ME+  KIACFV+LCMVV AP AEA+TCGQVT+ LAPCL YL+  GPLG CCGGVK L+ S
Sbjct:     1 MEMVSKIACFVLLCMVVVAPHAEALTCGQVTAGLAPCLPYLQGRGPLGGCCGGVKGLLGS 60

Query:   350 ARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCS 502
             A+TT DR+ ACTCLKSAA AI GI+L KAAG+PS C VNIPYKISPSTDCS
Sbjct:    61 AKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCS 111

 

sp|P27056|NLT2_LYCES NONSPECIFIC LIPID-TRANSFER PROTEIN 2 PRECURSOR
            (LTP 2) pir||S20862 probable lipid transfer protein precursor -
            tomato gi|19392 (X56040) TSW12 gene product [Lycopersicon esculentum]
            Length = 114

  Plus Strand HSPs:

 Score = 445 (203.9 bits), Expect = 1.2e-52, P = 1.2e-52
 Identities = 83/111 (74%), Positives = 93/111 (83%), Frame = +2

Query:   170 MEIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNS 349
             ME+  KIACFV+LCMVV AP AEA+TCGQVT+ LAPCL YL+  GPLG CCGGVK L+ S
Sbjct:     1 MEMVSKIACFVLLCMVVVAPHAEALTCGQVTAGLAPCLPYLQGRGPLGGCCGGVKNLLGS 60

Query:   350 ARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCS 502
             A+TT DR+ ACTCLKSAA AI GI+L KAAG+PS C VNIPYKISPSTDCS
Sbjct:    61 AKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCS 111

 

sp|P93224|NLT1_LYCES NONSPECIFIC LIPID-TRANSFER PROTEIN 1 PRECURSOR
            (LTP 1) gi|1816535 (U81996) non specific lipid transfer protein
            [Lycopersicon esculentum]
            Length = 114

  Plus Strand HSPs:

 Score = 443 (202.9 bits), Expect = 2.2e-52, P = 2.2e-52
 Identities = 81/111 (72%), Positives = 92/111 (82%), Frame = +2

Query:   170 MEIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNS 349
             ME+ GKIACFVV CMVV AP AE+++CG+VTS LAPCL YL   GPLG CCGGVK L+ +
Sbjct:     1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGCCGGVKGLLGA 60

Query:   350 ARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCS 502
             A+T EDR+ ACTCLKSAA +I GI+ GKAAGLP  CGVNIPYKISPSTDCS
Sbjct:    61 AKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCS 111

 

sp|Q43017|NLT1_PRUDU NONSPECIFIC LIPID-TRANSFER PROTEIN 1 PRECURSOR
            (LTP 1) gnl|PID|e242606 (X96714) lipid transfer protein [Prunus dulcis]
            Length = 117

  Plus Strand HSPs:

 Score = 147 (67.3 bits), Expect = 5.1e-35, Sum P(2) = 5.1e-35
 Identities = 27/46 (58%), Positives = 34/46 (73%), Frame = +2

Query:   185 KIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCC 322
             K+A  V LCMVV+ P A+AITCGQV+SNLAPC+ Y+R  G +   C
Sbjct:     8 KLALVVALCMVVSVPIAQAITCGQVSSNLAPCIPYVRGGGAVPPAC 53

 Score = 205 (93.9 bits), Expect = 5.1e-35, Sum P(2) = 5.1e-35
 Identities = 35/62 (56%), Positives = 45/62 (72%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC G++ + N ARTT DRQ AC CLK  + ++ G+N   AA LP  CGVNIPY+ISPST+
Sbjct:    53 CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTN 112

Query:   497 CS 502
             C+
Sbjct:   113 CA 114

 

sp|P10976|NLTP_SPIOL NONSPECIFIC LIPID-TRANSFER PROTEIN PRECURSOR (LTP)
            (PHOSPHOLIPID TRANSFER PROTEIN) (PLTP) gi|170117 (M58635) lipid
            transfer protein [Spinacia oleracea] prf||1803519A lipid transfer
            protein [Spinacia oleracea]
            Length = 117

  Plus Strand HSPs:

 Score = 87 (39.9 bits), Expect = 0.0028, P = 0.0028
 Identities = 24/59 (40%), Positives = 31/59 (52%), Frame = +2

Query:   185 KIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNSARTT 361
             K+AC V+LC+VVAAP AEA     + S+           GPLG  C G    +N+A  T
Sbjct:     8 KLACAVLLCIVVAAPYAEAGITCGMVSSKLAPCIGYLKGGPLGGGCCGGIKALNAAAAT 66

 Score = 306 (140.2 bits), Expect = 1.7e-33, P = 1.7e-33
 Identities = 59/97 (60%), Positives = 69/97 (71%), Frame = +2

Query:   212 MVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNSARTTEDRQIACTCL 391
             +V A      ITCG V+S LAPC+ YL+     G CCGG+KAL  +A TT DR+ AC CL
Sbjct:    18 VVAAPYAEAGITCGMVSSKLAPCIGYLKGGPLGGGCCGGIKALNAAAATTPDRKTACNCL 77

Query:   392 KSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCS 502
             KSAA AI GIN GKAAGLP  CGV+IPY ISPST+C+
Sbjct:    78 KSAANAIKGINYGKAAGLPGMCGVHIPYAISPSTNCN 114

 

sp|P19656|NLTP_MAIZE NONSPECIFIC LIPID-TRANSFER PROTEIN PRECURSOR (LTP)
            (PHOSPHOLIPID TRANSFER PROTEIN) (PLTP) pir||A31779 phospholipid
            transfer protein 9C2 precursor - maize gi|168576 (J04176)
            phospholipid transfer protein precursor [Zea mays]
            Length = 120

  Plus Strand HSPs:

 Score = 99 (45.4 bits), Expect = 4.3e-33, Sum P(2) = 4.3e-33
 Identities = 19/48 (39%), Positives = 29/48 (60%), Frame = +2

Query:   161 SKTMEIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTG 304
             ++T ++A      V L ++ AA    AI+CGQV S +APC++Y R  G
Sbjct:     2 ARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQG 49

 Score = 239 (109.5 bits), Expect = 4.3e-33, Sum P(2) = 4.3e-33
 Identities = 42/71 (59%), Positives = 54/71 (76%), Frame = +2

Query:   293 RNTGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIP 472
             + +GP   CC GV++L N+ARTT DR+ AC CLK+AA  +SG+N G AA +PS CGV+IP
Sbjct:    48 QGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIP 107

Query:   473 YKISPSTDCSK 505
             Y IS STDCS+
Sbjct:   108 YTISTSTDCSR 118

 

sp|Q42999|NLT3_ORYSA NONSPECIFIC LIPID-TRANSFER PROTEIN 3 PRECURSOR
            (LTP 3) gi|510337 (Z23271) lipid transfer protein [Oryza sativa]
            Length = 117

  Plus Strand HSPs:

 Score = 293 (134.2 bits), Expect = 1.1e-31, P = 1.1e-31
 Identities = 52/89 (58%), Positives = 67/89 (75%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISG 418
             AI+CGQV S ++PCL+Y R   P   CC GV++L ++A TT DR+ AC CLK+ AG+ISG
Sbjct:    27 AISCGQVNSAVSPCLSYARGLRPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISG 86

Query:   419 INLGKAAGLPSTCGVNIPYKISPSTDCSK 505
             +N G AA +PS CGV+IPY ISPS DCS+
Sbjct:    87 LNAGNAASIPSKCGVSIPYTISPSIDCSR 115

 

prf||1906368A le16 gene [Lycopersicon esculentum]
            Length = 119

  Plus Strand HSPs:

 Score = 231 (105.8 bits), Expect = 8.8e-31, Sum P(2) = 8.8e-31
 Identities = 42/62 (67%), Positives = 49/62 (79%), Frame = +2

Query:   170 MEIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNS 349
             ME+ GKIACFVV CMVV AP AE+++CG+VTS LAPCL YL   GPLG CCGGVK L+ +
Sbjct:     1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGCCGGVKGLLGA 60

Query:   350 AR 355
              R
Sbjct:    61 RR 62

 Score = 90 (41.2 bits), Expect = 8.8e-31, Sum P(2) = 8.8e-31
 Identities = 26/52 (50%), Positives = 30/52 (57%), Frame = +3

Query:   357 PQKIVKLHALA*NQLQVLFLESIWAKLLVSLVLVVSIFLTRSALPLTAPSTS 512
             PQK  +  ALA N+  +L    I  K L SL  V S FLTRSALPL A  +S
Sbjct:    63 PQKTGRQRALALNRQLILLRALIQEKPLGSLEFVESTFLTRSALPLIAQRSS 114

 

gi|1498597 (U66105) phospholipid transfer protein [Zea mays]
            Length = 121

  Plus Strand HSPs:

 Score = 100 (45.8 bits), Expect = 1.7e-30, Sum P(2) = 1.7e-30
 Identities = 20/43 (46%), Positives = 26/43 (60%), Frame = +2

Query:   176 IAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTG 304
             +A  +   V+L    A     AITCGQV+S +APCL+Y R TG
Sbjct:     8 VAVAVVAAVLLLAAAATTSEAAITCGQVSSAIAPCLSYARGTG 50

 Score = 219 (100.3 bits), Expect = 1.7e-30, Sum P(2) = 1.7e-30
 Identities = 39/69 (56%), Positives = 50/69 (72%), Frame = +2

Query:   299 TGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYK 478
             +GP   CC GV+ L ++A T  DR+ AC CLK+AA  +SG+N G AA +PS CGV+IPY 
Sbjct:    51 SGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSKCGVSIPYT 110

Query:   479 ISPSTDCSK 505
             IS STDCS+
Sbjct:   111 ISTSTDCSR 119

 

sp|Q43194|NLT2_SORVU NONSPECIFIC LIPID-TRANSFER PROTEIN 2 PRECURSOR
            (LTP 2) pir||S33461 lipid transfer protein - sorghum gi|311333
            (X71668) lipid transfer protein [Sorghum bicolor]
            Length = 122

  Plus Strand HSPs:

 Score = 84 (38.5 bits), Expect = 1.7e-30, Sum P(2) = 1.7e-30
 Identities = 16/48 (33%), Positives = 25/48 (52%), Frame = +2

Query:   161 SKTMEIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTG 304
             S  + +A  +       ++ A     A+TCGQV+S + PCL+Y R  G
Sbjct:     4 SMKLAVAIAVVAAAAAVVLAATTSEAAVTCGQVSSAIGPCLSYARGQG 51

 Score = 235 (107.7 bits), Expect = 1.7e-30, Sum P(2) = 1.7e-30
 Identities = 42/71 (59%), Positives = 55/71 (77%), Frame = +2

Query:   293 RNTGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIP 472
             + +GP   CC GV++L ++ARTT DR+ AC CLK+AA  I G+N+GKAA +PS CGV+IP
Sbjct:    50 QGSGPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGIRGLNVGKAASIPSKCGVSIP 109

Query:   473 YKISPSTDCSK 505
             Y IS STDCS+
Sbjct:   110 YTISTSTDCSR 120

 

pir||S00060 phospholipid transfer protein - spinach
            Length = 91

  Plus Strand HSPs:

 Score = 283 (129.6 bits), Expect = 2.6e-30, P = 2.6e-30
 Identities = 55/87 (63%), Positives = 64/87 (73%), Frame = +2

Query:   242 ITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGI 421
             ITCG V+S LAPC+ YL+     G   GG+KAL  +A TT DR+ AC CLKSAA AI GI
Sbjct:     2 ITCGMVSSKLAPCIGYLKGGPLGGGSSGGIKALNAAAATTPDRKTACNCLKSAANAIKGI 61

Query:   422 NLGKAAGLPSTCGVNIPYKISPSTDCS 502
             N GKAAGLP  CGV+IPY ISPST+C+
Sbjct:    62 NYGKAAGLPGMCGVHIPYAISPSTNCN 88

 

pdb|1MZM|   Maize Nonspecific Lipid Transfer Protein Complexed With
          Palmitate Alpha-Helical Structure, Lipid Transport Mol_id: 1;
          Molecule: Maize Nonspecific Lipid Transfer Protein; Chain: Null
          pdb|1MZL|   Maize Nonspecific Lipid Transfer Protein Alpha-Helical
          Structure, Lipid Transport Mol_id: 1; Molecule: Maize Nonspecific
          Lipid Transfer Protein; Chain: Null pdb|1AFH|   Lipid Transfer
          Protein From Maize Seedlings, Nmr, 15 Structures Lipid-Binding
          Protein, Lipid Transfer Protein, Maize, Molecular Modeling, Nmr
          Mol_id: 1; Molecule: Maize Nonspecific Lipid Transfer Protein; Chain:
          Null
          Length = 93

  Plus Strand HSPs:

 Score = 76 (34.8 bits), Expect = 3.6e-30, Sum P(2) = 3.6e-30
 Identities = 13/22 (59%), Positives = 17/22 (77%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTG 304
             AI+CGQV S +APC++Y R  G
Sbjct:     1 AISCGQVASAIAPCISYARGQG 22

 Score = 239 (109.5 bits), Expect = 3.6e-30, Sum P(2) = 3.6e-30
 Identities = 42/71 (59%), Positives = 54/71 (76%), Frame = +2

Query:   293 RNTGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIP 472
             + +GP   CC GV++L N+ARTT DR+ AC CLK+AA  +SG+N G AA +PS CGV+IP
Sbjct:    21 QGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIP 80

Query:   473 YKISPSTDCSK 505
             Y IS STDCS+
Sbjct:    81 YTISTSTDCSR 91

 

sp|Q42616|NLT3_BRANA NONSPECIFIC LIPID-TRANSFER PROTEIN 3 PRECURSOR
            (LTP 3) gi|732524 (U22175) germination-specific lipid transfer
            protein 3 [Brassica napus]
            Length = 117

  Plus Strand HSPs:

 Score = 56 (25.7 bits), Expect = 5.6e-30, Sum P(3) = 5.6e-30
 Identities = 9/17 (52%), Positives = 13/17 (76%), Frame = +2

Query:   185 KIACFVVLCMVVAAPCA 235
             K++C V+ CM+VA P A
Sbjct:     6 KLSCLVLACMIVAGPIA 22

 Score = 80 (36.6 bits), Expect = 5.6e-30, Sum P(3) = 5.6e-30
 Identities = 13/28 (46%), Positives = 18/28 (64%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTGPLGRCC 322
             A++CG V+ NLA C+ YL   GP+   C
Sbjct:    26 ALSCGTVSGNLAACIGYLTQNGPVPTAC 53

 Score = 209 (95.7 bits), Expect = 5.6e-30, Sum P(3) = 5.6e-30
 Identities = 39/62 (62%), Positives = 46/62 (74%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC GV +L N ARTT DRQ AC CL  AA A+  IN+ +AAGLP  CGVNIPYKIS +T+
Sbjct:    53 CCSGVTSLNNMARTTPDRQQACRCLVGAANALPTINVARAAGLPKACGVNIPYKISKTTN 112

Query:   497 CS 502
             C+
Sbjct:   113 CN 114

 

pir||JH0379 phospholipid transfer protein 6B6 - maize (fragment)
            gi|168578 (M57249) phospholipid transfer protein [Zea mays]
            Length = 99

  Plus Strand HSPs:

 Score = 68 (31.2 bits), Expect = 5.6e-30, Sum P(2) = 5.6e-30
 Identities = 11/20 (55%), Positives = 15/20 (75%), Frame = +2

Query:   245 TCGQVTSNLAPCLAYLRNTG 304
             +CGQV S +APC++Y R  G
Sbjct:     1 SCGQVASAIAPCISYARGQG 20

 Score = 246 (112.7 bits), Expect = 5.6e-30, Sum P(2) = 5.6e-30
 Identities = 43/72 (59%), Positives = 55/72 (76%), Frame = +2

Query:   293 RNTGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIP 472
             + +GP   CC GV++L N+ARTT DR+ AC CLK+AA  +SG+N G AA +PS CGV+IP
Sbjct:    19 QGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIP 78

Query:   473 YKISPSTDCSKY 508
             Y IS STDCS+Y
Sbjct:    79 YTISTSTDCSRY 90

 

sp|Q42614|NLT1_BRANA NONSPECIFIC LIPID-TRANSFER PROTEIN 1 PRECURSOR
            (LTP 1) gi|732520 (U22105) germination-specific lipid transfer
            protein 1 [Brassica napus]
            Length = 117

  Plus Strand HSPs:

 Score = 56 (25.7 bits), Expect = 1.0e-29, Sum P(3) = 1.0e-29
 Identities = 9/17 (52%), Positives = 13/17 (76%), Frame = +2

Query:   185 KIACFVVLCMVVAAPCA 235
             K++C V+ CM+VA P A
Sbjct:     6 KLSCLVLACMIVAGPIA 22

 Score = 86 (39.4 bits), Expect = 1.0e-29, Sum P(3) = 1.0e-29
 Identities = 15/28 (53%), Positives = 19/28 (67%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTGPLGRCC 322
             A++CG V+ NLA C+ YL   GPL R C
Sbjct:    26 ALSCGTVSGNLAACIGYLTQNGPLPRGC 53

 Score = 201 (92.1 bits), Expect = 1.0e-29, Sum P(3) = 1.0e-29
 Identities = 39/62 (62%), Positives = 43/62 (69%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC GV  L N ARTT DRQ AC CL  AA A   +N  +AAGLP  CGVNIPYKIS ST+
Sbjct:    53 CCTGVTNLNNMARTTPDRQQACRCLVGAANAFPTLNAARAAGLPKACGVNIPYKISKSTN 112

Query:   497 CS 502
             C+
Sbjct:   113 CN 114

 

sp|Q42642|NLTB_BRAOL NONSPECIFIC LIPID-TRANSFER PROTEIN B PRECURSOR
            (LTP B) (WAX-ASSOCIATED PROTEIN 9B) gi|500843 (L33905) lipid
            transfer protein [Brassica oleracea]
            Length = 117

  Plus Strand HSPs:

 Score = 56 (25.7 bits), Expect = 2.6e-29, Sum P(3) = 2.6e-29
 Identities = 9/17 (52%), Positives = 13/17 (76%), Frame = +2

Query:   185 KIACFVVLCMVVAAPCA 235
             K++C V+ CM+VA P A
Sbjct:     6 KLSCLVLACMIVAGPIA 22

 Score = 86 (39.4 bits), Expect = 2.6e-29, Sum P(3) = 2.6e-29
 Identities = 15/28 (53%), Positives = 19/28 (67%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTGPLGRCC 322
             A++CG V+ NLA C+ YL   GPL R C
Sbjct:    26 ALSCGTVSGNLAACIGYLTQNGPLPRGC 53

 Score = 198 (90.7 bits), Expect = 2.6e-29, Sum P(3) = 2.6e-29
 Identities = 38/62 (61%), Positives = 43/62 (69%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC GV  L N ARTT DRQ AC CL  AA +   +N  +AAGLP  CGVNIPYKIS ST+
Sbjct:    53 CCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTN 112

Query:   497 CS 502
             C+
Sbjct:   113 CN 114

 

sp|Q42762|NLT1_GOSHI NONSPECIFIC LIPID-TRANSFER PROTEIN PRECURSOR (LTP)
            gi|995907 (U15153) nonspecific lipid transfer protein precursor
            [Gossypium hirsutum]
            Length = 116

  Plus Strand HSPs:

 Score = 70 (32.1 bits), Expect = 0.61, P = 0.46
 Identities = 14/28 (50%), Positives = 17/28 (60%), Frame = +2

Query:   185 KIACFVVLCMVVAAPCAEAITCGQVTSN 268
             K+AC VVLCMVV AP A+        +N
Sbjct:     4 KLACVVVLCMVVGAPLAQGAVTSGQVTN 31

 Score = 82 (37.6 bits), Expect = 2.7e-29, Sum P(2) = 2.7e-29
 Identities = 17/35 (48%), Positives = 24/35 (68%), Frame = +2

Query:   200 VVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTG 304
             V+  +V A     A+T GQVT++LAPC+ YLR +G
Sbjct:    10 VLCMVVGAPLAQGAVTSGQVTNSLAPCINYLRGSG 44

 Score = 228 (104.4 bits), Expect = 2.7e-29, Sum P(2) = 2.7e-29
 Identities = 41/62 (66%), Positives = 50/62 (80%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC G+K+L ++A+TT  RQ AC C+KSAA  I+GIN G A+GLP  CGVNIPYKISPSTD
Sbjct:    52 CCTGIKSLNSAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTD 111

Query:   497 CS 502
             C+
Sbjct:   112 CN 113

 

sp|Q43129|NLT2_GOSHI NONSPECIFIC LIPID-TRANSFER PROTEIN PRECURSOR (LTP)
            bbs|166991 (S78173) LTP=lipid transfer protein [Gossypium
            hirsutum=cotton, fiber, Peptide, 120 aa] [Gossypium hirsutum]
            Length = 120

  Plus Strand HSPs:

 Score = 70 (32.1 bits), Expect = 0.61, P = 0.46
 Identities = 14/28 (50%), Positives = 17/28 (60%), Frame = +2

Query:   185 KIACFVVLCMVVAAPCAEAITCGQVTSN 268
             K+AC VVLCMVV AP A+        +N
Sbjct:     8 KLACVVVLCMVVGAPLAQGAVTSGQVTN 35

 Score = 82 (37.6 bits), Expect = 2.8e-29, Sum P(2) = 2.8e-29
 Identities = 17/35 (48%), Positives = 24/35 (68%), Frame = +2

Query:   200 VVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTG 304
             V+  +V A     A+T GQVT++LAPC+ YLR +G
Sbjct:    14 VLCMVVGAPLAQGAVTSGQVTNSLAPCINYLRGSG 48

 Score = 228 (104.4 bits), Expect = 2.8e-29, Sum P(2) = 2.8e-29
 Identities = 41/62 (66%), Positives = 50/62 (80%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC G+K+L ++A+TT  RQ AC C+KSAA  I+GIN G A+GLP  CGVNIPYKISPSTD
Sbjct:    56 CCTGIKSLNSAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTD 115

Query:   497 CS 502
             C+
Sbjct:   116 CN 117

 

sp|Q42615|NLT2_BRANA NONSPECIFIC LIPID-TRANSFER PROTEIN 2 PRECURSOR
            (LTP 2) gi|732522 (U22174) germination-specific lipid transfer
            protein 2 [Brassica napus]
            Length = 117

  Plus Strand HSPs:

 Score = 56 (25.7 bits), Expect = 6.7e-29, Sum P(3) = 6.7e-29
 Identities = 9/15 (60%), Positives = 12/15 (80%), Frame = +2

Query:   185 KIACFVVLCMVVAAP 229
             K+AC V+ CM+VA P
Sbjct:     6 KLACLVLACMIVAGP 20

 Score = 83 (38.0 bits), Expect = 6.7e-29, Sum P(3) = 6.7e-29
 Identities = 14/28 (50%), Positives = 19/28 (67%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTGPLGRCC 322
             A++CG V+  +APC+ YL   GPL R C
Sbjct:    26 ALSCGTVSGYVAPCIGYLTQNGPLPRGC 53

 Score = 198 (90.7 bits), Expect = 6.7e-29, Sum P(3) = 6.7e-29
 Identities = 38/62 (61%), Positives = 43/62 (69%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC GV  L N ARTT DRQ AC CL  AA +   +N  +AAGLP  CGVNIPYKIS ST+
Sbjct:    53 CCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTN 112

Query:   497 CS 502
             C+
Sbjct:   113 CN 114

 

sp|P27631|NLTP_DAUCA NONSPECIFIC LIPID-TRANSFER PROTEIN PRECURSOR (LTP)
            (EXTRACELLULAR PROTEIN 2) pir||JQ1280 lipid transfer protein EP2
            precursor - carrot gi|167554 (M64746) lipid transfer protein
            [Daucus carota]
            Length = 120

  Plus Strand HSPs:

 Score = 79 (36.2 bits), Expect = 3.5e-28, Sum P(2) = 3.5e-28
 Identities = 14/19 (73%), Positives = 16/19 (84%), Frame = +2

Query:   242 ITCGQVTSNLAPCLAYLRN 298
             +TCGQVT  LAPCL YLR+
Sbjct:    28 LTCGQVTGALAPCLGYLRS 46

 Score = 223 (102.2 bits), Expect = 3.5e-28, Sum P(2) = 3.5e-28
 Identities = 39/63 (61%), Positives = 50/63 (79%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC  V+ L N+ARTT D++ AC CLK  A A++G+NL  AAGLP+ CGVNIPYKISP+TD
Sbjct:    56 CCNVVRGLNNAARTTLDKRTACGCLKQTANAVTGLNLNAAAGLPARCGVNIPYKISPTTD 115

Query:   497 CSK 505
             C++
Sbjct:   116 CNR 118

 

sp|Q43193|NLT1_SORVU NONSPECIFIC LIPID-TRANSFER PROTEIN 1 PRECURSOR
            (LTP 1) pir||S33459 lipid transfer protein - sorghum gi|311331
            (X71667) lipid transfer protein [Sorghum bicolor]
            Length = 118

  Plus Strand HSPs:

 Score = 75 (34.4 bits), Expect = 8.7e-28, Sum P(2) = 8.7e-28
 Identities = 15/34 (44%), Positives = 22/34 (64%), Frame = +2

Query:   203 VLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTG 304
             V+ ++ A     AI+CGQV+S +A CL+Y R  G
Sbjct:    14 VVVVLAATTSEAAISCGQVSSAIALCLSYARGQG 47

 Score = 224 (102.6 bits), Expect = 8.7e-28, Sum P(2) = 8.7e-28
 Identities = 40/67 (59%), Positives = 51/67 (76%), Frame = +2

Query:   305 PLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKIS 484
             P   CC GV++L ++ARTT DR+ AC CLK+AA  ISG+N G AA +PS CGV++PY IS
Sbjct:    50 PSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGISGLNAGNAASIPSKCGVSVPYTIS 109

Query:   485 PSTDCSK 505
              STDCS+
Sbjct:   110 TSTDCSR 116

 

sp|Q43304|NLTD_BRAOL NONSPECIFIC LIPID-TRANSFER PROTEIN D PRECURSOR
            (LTP D) (WAX-ASSOCIATED PROTEIN 9D) pir||S45680 lipid transfer
            protein - broccoli gi|463043 (L29767) lipid transfer protein
            [Brassica oleracea] gi|500847 (L33907) lipid transfer protein
            [Brassica oleracea]
            Length = 118

  Plus Strand HSPs:

 Score = 53 (24.3 bits), Expect = 2.1e-27, Sum P(3) = 2.1e-27
 Identities = 8/15 (53%), Positives = 11/15 (73%), Frame = +2

Query:   185 KIACFVVLCMVVAAP 229
             K+AC +  CM+VA P
Sbjct:     6 KLACLIFACMIVAGP 20

 Score = 64 (29.3 bits), Expect = 2.1e-27, Sum P(3) = 2.1e-27
 Identities = 10/23 (43%), Positives = 15/23 (65%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTGP 307
             A++CG V+  +APC+ YL    P
Sbjct:    26 ALSCGTVSGYVAPCIGYLAQNAP 48

 Score = 209 (95.7 bits), Expect = 2.1e-27, Sum P(3) = 2.1e-27
 Identities = 39/62 (62%), Positives = 46/62 (74%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC GV +L N ARTT DRQ AC CL  AA A+  IN+ +AAGLP  CGVNIPYKIS +T+
Sbjct:    54 CCSGVTSLNNMARTTPDRQQACRCLVGAANALPTINVARAAGLPKACGVNIPYKISKTTN 113

Query:   497 CS 502
             C+
Sbjct:   114 CN 115

 

sp|P23096|NLT1_ORYSA NONSPECIFIC LIPID-TRANSFER PROTEIN 1 PRECURSOR
            (LTP 1) (PAPI) gnl|PID|e274396 (Y08691) lipid transfer protein
            [Oryza sativa] gi|1667590 (U77295) lipid transfer protein [Oryza
            sativa]
            Length = 116

  Plus Strand HSPs:

 Score = 82 (37.6 bits), Expect = 2.2e-27, Sum P(2) = 2.2e-27
 Identities = 17/45 (37%), Positives = 21/45 (46%), Frame = +2

Query:   188 IACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCC 322
             +   V   ++ A   A AITCGQV S + PCL Y R        C
Sbjct:     8 LVALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAAC 52

 Score = 214 (98.0 bits), Expect = 2.2e-27, Sum P(2) = 2.2e-27
 Identities = 38/68 (55%), Positives = 48/68 (70%), Frame = +2

Query:   302 GPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKI 481
             GP   CC GV++L  +A TT DR+ AC CLK+AA  I G+N G AA +PS CGV++PY I
Sbjct:    47 GPSAACCSGVRSLFAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTI 106

Query:   482 SPSTDCSK 505
             S S DCS+
Sbjct:   107 SASIDCSR 114

 

pir||S49198 Cw-19 peptide, non specific lipid transfer protein,
            precursor - barley gi|510528 (X68656) Cw-19 peptide,non specific
            lipid transfer protein [Hordeum vulgare]
            Length = 118

  Plus Strand HSPs:

 Score = 77 (35.3 bits), Expect = 3.7e-26, Sum P(2) = 3.7e-26
 Identities = 13/22 (59%), Positives = 18/22 (81%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTG 304
             AI+CGQV+S L+PC++Y R  G
Sbjct:    26 AISCGQVSSALSPCISYARGNG 47

 Score = 210 (96.2 bits), Expect = 3.7e-26, Sum P(2) = 3.7e-26
 Identities = 36/63 (57%), Positives = 48/63 (76%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC GVK L  +A++T D+Q AC CLKS A +I GIN+GK +G+P  CGV++P+ IS STD
Sbjct:    54 CCSGVKRLAGAAQSTADKQAACRCLKSLATSIKGINMGKVSGVPGKCGVSVPFPISMSTD 113

Query:   497 CSK 505
             C+K
Sbjct:   114 CNK 116

 

bbs|163497 acyl-binding/lipid-transfer protein isoform III, AB/LTP III
            [rape, seedlings, Peptide, 92 aa] prf||2107184A acyl-binding/lipid
            transfer protein:ISOTYPE=III [Brassica napus]
            Length = 92

  Plus Strand HSPs:

 Score = 86 (39.4 bits), Expect = 5.9e-26, Sum P(2) = 5.9e-26
 Identities = 15/28 (53%), Positives = 19/28 (67%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTGPLGRCC 322
             A++CG V+ NLA C+ YL   GPL R C
Sbjct:     1 ALSCGTVSGNLAACIGYLTQNGPLPRGC 28

 Score = 198 (90.7 bits), Expect = 5.9e-26, Sum P(2) = 5.9e-26
 Identities = 38/62 (61%), Positives = 43/62 (69%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC GV  L N ARTT DRQ AC CL  AA +   +N  +AAGLP  CGVNIPYKIS ST+
Sbjct:    28 CCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTN 87

Query:   497 CS 502
             C+
Sbjct:    88 CN 89

 

gi|19039 (X60292) LTP 1 [Hordeum vulgare]
            Length = 134

  Plus Strand HSPs:

 Score = 79 (36.2 bits), Expect = 7.6e-26, Sum P(2) = 7.6e-26
 Identities = 15/36 (41%), Positives = 22/36 (61%), Frame = +2

Query:   188 IACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLR 295
             +A  +VL +  A   A A+ CGQV S + PCL Y++
Sbjct:     9 MAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQ 44

 Score = 208 (95.3 bits), Expect = 7.6e-26, Sum P(2) = 7.6e-26
 Identities = 36/69 (52%), Positives = 45/69 (65%), Frame = +2

Query:   302 GPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKI 481
             GP G CC GV+ L N A+++ DRQ  C CLK  A  I  +NL  AA +PS C VN+PY I
Sbjct:    48 GPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTI 107

Query:   482 SPSTDCSKY 508
             SP  DCS++
Sbjct:   108 SPDIDCSRF 116

 

sp|P07597|NLT1_HORVU NONSPECIFIC LIPID-TRANSFER PROTEIN 1 PRECURSOR
            (LTP 1) (PAPI) pir||S20507 phospholipid transfer protein precursor
            - barley pir||S18205 lipid transfer protein - barley gi|19037
            (X59253) lipid transfer protein [Hordeum vulgare] gi|21820 (X05168)
            precursor [Triticum aestivum] gi|167077 (M15207) amylase/protease
            inhibitor [Hordeum vulgare]
            Length = 117

  Plus Strand HSPs:

 Score = 79 (36.2 bits), Expect = 9.4e-26, Sum P(2) = 9.4e-26
 Identities = 15/36 (41%), Positives = 22/36 (61%), Frame = +2

Query:   188 IACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLR 295
             +A  +VL +  A   A A+ CGQV S + PCL Y++
Sbjct:     9 MAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQ 44

 Score = 205 (93.9 bits), Expect = 9.4e-26, Sum P(2) = 9.4e-26
 Identities = 36/68 (52%), Positives = 44/68 (64%), Frame = +2

Query:   302 GPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKI 481
             GP G CC GV+ L N A+++ DRQ  C CLK  A  I  +NL  AA +PS C VN+PY I
Sbjct:    48 GPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTI 107

Query:   482 SPSTDCSK 505
             SP  DCS+
Sbjct:   108 SPDIDCSR 115

 

gnl|PID|e234051 (X96979) lipid transfer protein 7a2b [Hordeum vulgare]
            Length = 122

  Plus Strand HSPs:

 Score = 85 (38.9 bits), Expect = 1.4e-25, Sum P(2) = 1.4e-25
 Identities = 15/39 (38%), Positives = 24/39 (61%), Frame = +2

Query:   176 IAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYL 292
             +A  +    V+ M+     + A++CGQV S LAPC+AY+
Sbjct:     9 VAAAVVLAAVVLMMAGREASAALSCGQVDSKLAPCVAYV 47

 Score = 198 (90.7 bits), Expect = 1.4e-25, Sum P(2) = 1.4e-25
 Identities = 35/63 (55%), Positives = 46/63 (73%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC GV+ L   AR++ DRQ AC CLKS A +I  IN+GK +G+P  CGV++P+ IS STD
Sbjct:    58 CCSGVQGLNGLARSSPDRQTACRCLKSLATSIKAINMGKVSGVPGKCGVSVPFPISMSTD 117

Query:   497 CSK 505
             C+K
Sbjct:   118 CNK 120

 

pir||EPRZ phospholipid transfer protein homolog - rice
            Length = 91

  Plus Strand HSPs:

 Score = 68 (31.2 bits), Expect = 1.5e-25, Sum P(2) = 1.5e-25
 Identities = 13/27 (48%), Positives = 14/27 (51%), Frame = +2

Query:   242 ITCGQVTSNLAPCLAYLRNTGPLGRCC 322
             ITCGQV S + PCL Y R        C
Sbjct:     1 ITCGQVNSAVGPCLTYARGGAGPSAAC 27

 Score = 213 (97.6 bits), Expect = 1.5e-25, Sum P(2) = 1.5e-25
 Identities = 38/68 (55%), Positives = 48/68 (70%), Frame = +2

Query:   302 GPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKI 481
             GP   CC GV++L  +A TT DR+ AC CLK+AA  I G+N G AA +PS CGV++PY I
Sbjct:    22 GPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTI 81

Query:   482 SPSTDCSK 505
             S S DCS+
Sbjct:    82 SASIDCSR 89

 

gi|2407277 (AF017361) lipid transfer protein LPT IV [Oryza sativa]
            Length = 116

  Plus Strand HSPs:

 Score = 81 (37.1 bits), Expect = 1.7e-25, Sum P(2) = 1.7e-25
 Identities = 17/45 (37%), Positives = 21/45 (46%), Frame = +2

Query:   188 IACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCC 322
             +   V   ++ A   A AITCGQV S + PCL Y R        C
Sbjct:     8 LVAVVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAAC 52

 Score = 201 (92.1 bits), Expect = 1.7e-25, Sum P(2) = 1.7e-25
 Identities = 36/68 (52%), Positives = 46/68 (67%), Frame = +2

Query:   302 GPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKI 481
             GP   CC GV++L  +A  T DR+ AC CLK+AA  I G+N G AA +PS CGV++PY I
Sbjct:    47 GPSAACCSGVRSLKAAASNTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTI 106

Query:   482 SPSTDCSK 505
             S S  CS+
Sbjct:   107 SASIHCSR 114

 

gi|1209260 (L31938) similar to lipid transfer protein [Brassica rapa]
            Length = 119

  Plus Strand HSPs:

 Score = 120 (55.0 bits), Expect = 3.4e-25, Sum P(2) = 3.4e-25
 Identities = 22/45 (48%), Positives = 28/45 (62%), Frame = +2

Query:   188 IACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCC 322
             I C +VL + +AAP    ITCG VTS +  C++YL N GPL   C
Sbjct:     8 ITCLLVLTIYIAAPTESHITCGTVTSTMTQCISYLTNGGPLPSSC 52

 Score = 160 (73.3 bits), Expect = 3.4e-25, Sum P(2) = 3.4e-25
 Identities = 30/61 (49%), Positives = 40/61 (65%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC  VK+L   A+TT DR+  C CLKSA   I G+N+   A LP+TCGV++ Y I  +T+
Sbjct:    52 CCVAVKSLNQMAQTTPDRRQVCECLKSAGKEIKGLNIDLVAALPTTCGVSLSYPIGFNTN 111

Query:   497 C 499
             C
Sbjct:   112 C 112

 

pir||S45370 non-specific lipid transfer protein Cw-18 - barley
            gi|443797 (X68655) Cw-18 peptide,non specific lipid transfer
            protein [Hordeum vulgare] gi|587444 (Z37114) lipid transfer protein
            precursor [Hordeum vulgare]
            Length = 115

  Plus Strand HSPs:

 Score = 87 (39.9 bits), Expect = 3.7e-25, Sum P(3) = 3.7e-25
 Identities = 17/42 (40%), Positives = 25/42 (59%), Frame = +2

Query:   179 AGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTG 304
             A K+A   ++  ++      AITCGQV+S L PC AY + +G
Sbjct:     6 ATKLALVALVAAMLLVAADAAITCGQVSSALGPCAAYAKGSG 47

 Score = 112 (51.3 bits), Expect = 3.7e-25, Sum P(3) = 3.7e-25
 Identities = 21/37 (56%), Positives = 23/37 (62%), Frame = +2

Query:   299 TGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGA 409
             T P   CC GVK L   AR+T D+Q  C CLKS AGA
Sbjct:    48 TSPSAGCCSGVKRLAGLARSTADKQATCRCLKSVAGA 84

 Score = 110 (50.4 bits), Expect = 3.7e-25, Sum P(3) = 3.7e-25
 Identities = 19/28 (67%), Positives = 23/28 (82%), Frame = +2

Query:   422 NLGKAAGLPSTCGVNIPYKISPSTDCSK 505
             N G+AAG+PS CGV++PY IS S DCSK
Sbjct:    86 NAGRAAGIPSRCGVSVPYTISASVDCSK 113

 

gi|899224 (X60318) pid:e41290 [Brassica napus] prf||1905428A
            phospholipid transfer protein [Brassica napus]
            Length = 119

  Plus Strand HSPs:

 Score = 119 (54.5 bits), Expect = 4.6e-25, Sum P(2) = 4.6e-25
 Identities = 21/45 (46%), Positives = 28/45 (62%), Frame = +2

Query:   188 IACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCC 322
             I C ++L + +AAP    ITCG VTS +  C++YL N GPL   C
Sbjct:     8 ITCLLILTIYIAAPTESHITCGTVTSTMTQCISYLTNGGPLPSSC 52

 Score = 160 (73.3 bits), Expect = 4.6e-25, Sum P(2) = 4.6e-25
 Identities = 30/61 (49%), Positives = 40/61 (65%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC  VK+L   A+TT DR+  C CLKSA   I G+N+   A LP+TCGV++ Y I  +T+
Sbjct:    52 CCVAVKSLNQMAQTTPDRRQVCECLKSAGKEIKGLNIDLVAALPTTCGVSLSYPIGFNTN 111

Query:   497 C 499
             C
Sbjct:   112 C 112

 

bbs|163499 acyl-binding/lipid-transfer protein isoform I, AB/LTP I
            [rape, seedlings, Peptide, 93 aa] prf||2107184C acyl-binding/lipid
            transfer protein:ISOTYPE=I [Brassica napus]
            Length = 93

  Plus Strand HSPs:

 Score = 64 (29.3 bits), Expect = 1.9e-24, Sum P(2) = 1.9e-24
 Identities = 10/23 (43%), Positives = 15/23 (65%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTGP 307
             A++CG V+  +APC+ YL    P
Sbjct:     1 ALSCGTVSGYVAPCIGYLAQNAP 23

 Score = 209 (95.7 bits), Expect = 1.9e-24, Sum P(2) = 1.9e-24
 Identities = 39/62 (62%), Positives = 46/62 (74%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC GV +L N ARTT DRQ AC CL  AA A+  IN+ +AAGLP  CGVNIPYKIS +T+
Sbjct:    29 CCSGVTSLNNMARTTPDRQQACRCLVGAANALPTINVARAAGLPKACGVNIPYKISKTTN 88

Query:   497 CS 502
             C+
Sbjct:    89 CN 90

 

sp|Q43019|NLT3_PRUDU NONSPECIFIC LIPID-TRANSFER PROTEIN 3 PRECURSOR
            (LTP 3) gnl|PID|e242609 (X96716) lipid transfer protein [Prunus dulcis]
            Length = 123

  Plus Strand HSPs:

 Score = 32 (14.7 bits), Expect = 2.1e-24, Sum P(4) = 2.1e-24
 Identities = 7/14 (50%), Positives = 8/14 (57%), Frame = +2

Query:   200 VVLCMVVAAPCAEA 241
             V+ CM V  P A A
Sbjct:    16 VMCCMAVGGPKAMA 29

 Score = 85 (38.9 bits), Expect = 2.1e-24, Sum P(4) = 2.1e-24
 Identities = 14/28 (50%), Positives = 19/28 (67%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTGPLGRCC 322
             A++CGQV +NL PC+ Y+ N G L   C
Sbjct:    30 AVSCGQVVNNLTPCINYVANGGALNPSC 57

 Score = 94 (43.1 bits), Expect = 2.1e-24, Sum P(4) = 2.1e-24
 Identities = 18/36 (50%), Positives = 22/36 (61%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGIN 424
             CC GV++L + A+TT DRQ  C CLK A   I   N
Sbjct:    57 CCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTN 92

 Score = 120 (55.0 bits), Expect = 2.1e-24, Sum P(4) = 2.1e-24
 Identities = 22/26 (84%), Positives = 22/26 (84%), Frame = +2

Query:   422 NLGKAAGLPSTCGVNIPYKISPSTDC 499
             N G AAGLP  CGVNIPYKISPSTDC
Sbjct:    94 NAGLAAGLPGKCGVNIPYKISPSTDC 119

 

pir||S28871 lipid transfer protein Cw(18) - barley bbs|122723
            CW18=non-specific lipid transfer protein [barley, cv. Bomi, leaves,
            Peptide, 90 aa]
            Length = 90

  Plus Strand HSPs:

 Score = 78 (35.7 bits), Expect = 2.2e-24, Sum P(3) = 2.2e-24
 Identities = 14/22 (63%), Positives = 17/22 (77%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTG 304
             AITCGQV+S L PC AY + +G
Sbjct:     1 AITCGQVSSALGPCAAYAKGSG 22

 Score = 112 (51.3 bits), Expect = 2.2e-24, Sum P(3) = 2.2e-24
 Identities = 21/37 (56%), Positives = 23/37 (62%), Frame = +2

Query:   299 TGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGA 409
             T P   CC GVK L   AR+T D+Q  C CLKS AGA
Sbjct:    23 TSPSAGCCSGVKRLAGLARSTADKQATCRCLKSVAGA 59

 Score = 110 (50.4 bits), Expect = 2.2e-24, Sum P(3) = 2.2e-24
 Identities = 19/28 (67%), Positives = 23/28 (82%), Frame = +2

Query:   422 NLGKAAGLPSTCGVNIPYKISPSTDCSK 505
             N G+AAG+PS CGV++PY IS S DCSK
Sbjct:    61 NAGRAAGIPSRCGVSVPYTISASVDCSK 88

 

prf||2115353B lipid transfer protein [Hordeum vulgare]
            Length = 115

  Plus Strand HSPs:

 Score = 76 (34.8 bits), Expect = 2.3e-24, Sum P(3) = 2.3e-24
 Identities = 13/22 (59%), Positives = 18/22 (81%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTG 304
             AI+CGQV+S L+PC++Y R  G
Sbjct:    26 AISCGQVSSALSPCISYARGKG 47

 Score = 113 (51.8 bits), Expect = 2.3e-24, Sum P(3) = 2.3e-24
 Identities = 19/37 (51%), Positives = 27/37 (72%), Frame = +2

Query:   305 PLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAIS 415
             P   CC GV++L  +AR+T D+Q AC C+K AAGA++
Sbjct:    50 PPAACCSGVRSLAGAARSTADKQAACRCIKRAAGALN 86

 Score = 114 (52.2 bits), Expect = 2.3e-24, Sum P(3) = 2.3e-24
 Identities = 20/33 (60%), Positives = 24/33 (72%), Frame = +2

Query:   407 AISGINLGKAAGLPSTCGVNIPYKISPSTDCSK 505
             A   +N GKAAG+P+ CGV +PY IS S DCSK
Sbjct:    81 AAGALNAGKAAGIPNKCGVRVPYAISASVDCSK 113

 

gi|1050918 (X92648) lipid transfer protein [Helianthus annuus]
            Length = 116

  Plus Strand HSPs:

 Score = 137 (62.8 bits), Expect = 3.5e-10, P = 3.5e-10
 Identities = 28/63 (44%), Positives = 39/63 (61%), Frame = +2

Query:   173 EIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNSA 352
             ++A  + C  V CMVV AP  EA++CGQV+S+LAPC++YL   G +   C      +NSA
Sbjct:     3 KMAMMVLCAGVTCMVVGAPYTEALSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSA 62

Query:   353 RTT 361
               T
Sbjct:    63 AKT 65

 Score = 236 (108.1 bits), Expect = 7.8e-24, P = 7.8e-24
 Identities = 43/63 (68%), Positives = 50/63 (79%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC GVK+L ++A+TT DRQ AC CLKSA  +ISG+N G AA  P  CGV+IPYKISPSTD
Sbjct:    52 CCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTD 111

Query:   497 CSK 505
             CSK
Sbjct:   112 CSK 114

 

pdb|1LIP|   Barley Lipid Transfer Protein (Nmr, 4 Structures) Mol_id:
          1; Molecule: Lipid Transfer Protein; Chain: Null pdb|1JTB|   Lipid
          Transfer Protein Complexed With Palmitoyl Coenzyme A, Nmr, 16
          Structures Lipid Transport, Lipid Transfer Protein Mol_id: 1;
          Molecule: Lipid Transfer Protein; Chain: Null; Synonym: Ltp
          Length = 91

  Plus Strand HSPs:

 Score = 59 (27.0 bits), Expect = 3.0e-23, Sum P(2) = 3.0e-23
 Identities = 9/18 (50%), Positives = 13/18 (72%), Frame = +2

Query:   242 ITCGQVTSNLAPCLAYLR 295
             + CGQV S + PCL Y++
Sbjct:     1 LNCGQVDSKMKPCLTYVQ 18

 Score = 205 (93.9 bits), Expect = 3.0e-23, Sum P(2) = 3.0e-23
 Identities = 36/68 (52%), Positives = 44/68 (64%), Frame = +2

Query:   302 GPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKI 481
             GP G CC GV+ L N A+++ DRQ  C CLK  A  I  +NL  AA +PS C VN+PY I
Sbjct:    22 GPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTI 81

Query:   482 SPSTDCSK 505
             SP  DCS+
Sbjct:    82 SPDIDCSR 89

 

bbs|163498 acyl-binding/lipid-transfer protein isoform II, AB/LTP II
            [rape, seedlings, Peptide, 93 aa] prf||2107184B acyl-binding/lipid
            transfer protein:ISOTYPE=II [Brassica napus]
            Length = 93

  Plus Strand HSPs:

 Score = 62 (28.4 bits), Expect = 3.2e-23, Sum P(2) = 3.2e-23
 Identities = 10/23 (43%), Positives = 15/23 (65%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTGP 307
             A++CG V+  +APC+ YL    P
Sbjct:     1 ALSCGTVSGYVAPCIGYLAQGAP 23

 Score = 202 (92.5 bits), Expect = 3.2e-23, Sum P(2) = 3.2e-23
 Identities = 38/62 (61%), Positives = 44/62 (70%), Frame = +2

Query:   317 CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTD 496
             CC GV +L N ARTT DRQ AC CL  AA A   +N  +AAGLP  CGVNIPYKIS +T+
Sbjct:    29 CCSGVTSLNNLARTTPDRQQACRCLVGAANAFPTLNAARAAGLPKACGVNIPYKISKTTN 88

Query:   497 CS 502
             C+
Sbjct:    89 CN 90

 

gi|2407275 (AF017360) lipid transfer protein LPT III [Oryza sativa]
            Length = 114

  Plus Strand HSPs:

 Score = 82 (37.6 bits), Expect = 3.7e-23, Sum P(3) = 3.7e-23
 Identities = 17/45 (37%), Positives = 21/45 (46%), Frame = +2

Query:   188 IACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCC 322
             +   V   ++ A   A AITCGQV S + PCL Y R        C
Sbjct:     8 LVALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAAC 52

 Score = 176 (80.6 bits), Expect = 3.7e-23, Sum P(3) = 3.7e-23
 Identities = 31/57 (54%), Positives = 40/57 (70%), Frame = +2

Query:   302 GPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIP 472
             GP   CC GV++L  +A TT DR+ AC CLK+AA  I G+N G AA +PS CGV++P
Sbjct:    47 GPSAACCNGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVP 103

 Score = 36 (16.5 bits), Expect = 3.7e-23, Sum P(3) = 3.7e-23
 Identities = 8/10 (80%), Positives = 8/10 (80%), Frame = +3

Query:   474 TRSALPLTAP 503
             T SALP TAP
Sbjct:   104 TPSALPSTAP 113

 

sp|Q42978|NLT2_ORYSA NONSPECIFIC LIPID-TRANSFER PROTEIN 2 PRECURSOR
            (LTP 2) gi|951334 (U31766) lipid transfer protein precursor [Oryza
            sativa]
            Length = 118

  Plus Strand HSPs:

 Score = 79 (36.2 bits), Expect = 0.035, P = 0.034
 Identities = 17/41 (41%), Positives = 23/41 (56%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNSARTT 361
             AI+CGQV S ++PCL+Y R        C      +NSA +T
Sbjct:    27 AISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAAST 67

 Score = 231 (105.8 bits), Expect = 3.8e-23, P = 3.8e-23
 Identities = 41/68 (60%), Positives = 51/68 (75%), Frame = +2

Query:   299 TGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYK 478
             +GP   CC GV++L ++A TT DR+ AC CLK+ AG+ISG+N G AA +PS CGV IPY 
Sbjct:    48 SGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVTIPYT 107

Query:   479 ISPSTDCS 502
             ISPS DCS
Sbjct:   108 ISPSIDCS 115

 

gnl|PID|e1184834 (AJ002958) lipid transfer protein [Cicer arietinum]
            Length = 116

  Plus Strand HSPs:

 Score = 43 (19.7 bits), Expect = 4.9e-23, Sum P(2) = 4.9e-23
 Identities = 7/19 (36%), Positives = 12/19 (63%), Frame = +2

Query:   185 KIACFVVLCMVVAAPCAEA 241
             K+ C  ++  +V AP AE+
Sbjct:     5 KVVCVALIMCIVIAPMAES 23

 Score = 221 (101.2 bits), Expect = 4.9e-23, Sum P(2) = 4.9e-23
 Identities = 42/67 (62%), Positives = 50/67 (74%), Frame = +2

Query:   302 GPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKI 481
             GP  +CCGGV+ L ++A TT DRQ AC CLKSAAG+IS +N   AA LP  C VNIPYKI
Sbjct:    46 GPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGSISRLNANNAAALPGKCVVNIPYKI 105

Query:   482 SPSTDCS 502
             S ST+C+
Sbjct:   106 STSTNCA 112

 Score = 103 (47.2 bits), Expect = 1.7e-05, P = 1.7e-05
 Identities = 22/54 (40%), Positives = 31/54 (57%), Frame = +2

Query:   200 VVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNSARTT 361
             +++C+V+A     AITCG+V + LAPCL YL+        C G    +NSA  T
Sbjct:    11 LIMCIVIAPMAESAITCGRVDTALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVT 64

 

gi|2407273 (AF017359) lipid transfer protein LPT II [Oryza sativa]
            Length = 118

  Plus Strand HSPs:

 Score = 76 (34.8 bits), Expect = 0.091, P = 0.087
 Identities = 17/41 (41%), Positives = 23/41 (56%), Frame = +2

Query:   239 AITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNSARTT 361
             AI+CGQV S ++PCL+Y R        C      +NSA +T
Sbjct:    27 AISCGQVNSAVSPCLSYPRGGSGPSAACCSGVRNLNSAAST 67

 Score = 229 (104.9 bits), Expect = 7.2e-23, P = 7.2e-23
 Identities = 41/68 (60%), Positives = 51/68 (75%), Frame = +2

Query:   299 TGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYK 478
             +GP   CC GV+ L ++A TT DR+ AC CLK+ AG+ISG+N G AA +PS CGV+IPY 
Sbjct:    48 SGPSAACCSGVRNLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYT 107

Query:   479 ISPSTDCS 502
             ISPS DCS
Sbjct:   108 ISPSIDCS 115

 

sp|Q42976|NLT4_ORYSA NONSPECIFIC LIPID-TRANSFER PROTEIN 4 PRECURSOR
            (LTP 4) gi|902058 (U29176) lipid transfer protein precursor [Oryza
            sativa]
            Length = 99

  Plus Strand HSPs:

 Score = 73 (33.4 bits), Expect = 1.3e-22, Sum P(2) = 1.3e-22
 Identities = 12/24 (50%), Positives = 19/24 (79%), Frame = +2

Query:   221 AAPCAEAITCGQVTSNLAPCLAYL 292
             A   + A++CG VTS++APCL+Y+
Sbjct:     1 AERASAAVSCGDVTSSIAPCLSYV 24

 Score = 187 (85.7 bits), Expect = 1.3e-22, Sum P(2) = 1.3e-22
 Identities = 32/71 (45%), Positives = 46/71 (64%), Frame = +2

Query:   293 RNTGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIP 472
             R + P   CC GV+ L   A ++ DR+ AC+CLK+ A +   +N+G AA +PS CGV++ 
Sbjct:    27 RESSPSSSCCSGVRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVA 86

Query:   473 YKISPSTDCSK 505
             + IS S DCSK
Sbjct:    87 FPISTSVDCSK 97

 

sp|Q43748|NLTP_BETVU NONSPECIFIC LIPID-TRANSFER PROTEIN PRECURSOR (LTP)
            gi|1212810 (X92748) IWF1' [Beta vulgaris]
            Length = 117

  Plus Strand HSPs:

 Score = 143 (65.5 bits), Expect = 5.2e-11, P = 5.2e-11
 Identities = 29/56 (51%), Positives = 35/56 (62%), Frame = +2

Query:   185 KIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNSA 352
             K  C +V+CM+VAAP AEAITCG V S LAPC+ YL+        C G    +NSA
Sbjct:     8 KFTCALVMCMMVAAPLAEAITCGLVASKLAPCIGYLQGAPGPSAACCGGIKSLNSA 63

 Score = 227 (104.0 bits), Expect = 1.4e-22, P = 1.4e-22
 Identities = 40/67 (59%), Positives = 52/67 (77%), Frame = +2

Query:   302 GPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKI 481
             GP   CCGG+K+L ++A +  DR+ ACTCLKSAA +I GIN GKAA LP  CGV++PY I
Sbjct:    48 GPSAACCGGIKSLNSAAASPADRKTACTCLKSAATSIKGINYGKAASLPRQCGVSVPYAI 107

Query:   482 SPSTDCS 502
             SP+T+C+
Sbjct:   108 SPNTNCN 114

 

sp|P24296|NLTA_WHEAT NONSPECIFIC LIPID-TRANSFER PROTEIN PRECURSOR (LTP)
            (PHOSPHOLIPID TRANSFER PROTEIN) (PLTP) pir||S22528 lipid transfer
            protein precursor - durum wheat (fragment) gi|21932 (X63669) lipid
            transfer protein [Triticum durum]
            Length = 113

  Plus Strand HSPs:

 Score = 67 (30.7 bits), Expect = 1.6e-22, Sum P(2) = 1.6e-22
 Identities = 14/36 (38%), Positives = 21/36 (58%), Frame = +2

Query:   188 IACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLR 295
             +A  +VL +      A AI CG V S + PCL+Y++
Sbjct:     6 MAVALVLMLAAVPRAAVAIDCGHVDSLVRPCLSYVQ 41

 Score = 193 (88.4 bits), Expect = 1.6e-22, Sum P(2) = 1.6e-22
 Identities = 36/68 (52%), Positives = 43/68 (63%), Frame = +2

Query:   302 GPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKI 481
             GP G+CC GVK L N AR+  DRQ AC CLK  A  I  +N   A  +P  CGVN+PY I
Sbjct:    45 GPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTI 104

Query:   482 SPSTDCSK 505
             S + DCS+
Sbjct:   105 SLNIDCSR 112


Parameters:

  V=100
  B=50
  H=0
  -filter
  SEG

  Lambda     K      H
     0.318   0.135   0.401

  Cutoff to enter 2nd pass: >= 47 ( 0.0 bits)

  E     S     T1     T2     X1     X2     W     Gap
  10.0      63      12      12      -16      -22      40      50

  Database:  Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR
    Posted date:  Dec 5, 1997  6:31 AM
  # of letters in database:  82,859,678
  # of sequences in database:  277,055



  Number of Hits to DB: 1st pass: 95836190, 2nd pass: 787701
  Number of Sequences: 1st pass: 277055, 2nd pass: 1124
  Number of extensions: 1st pass: 2107890, 2nd pass: 634413
  Number of successful extensions: 1st pass: 1124, 2nd pass: 4418
  Number of sequences better than 10: 128