821605 Homework 7

1.   (1) David Liu would like to know the possible functional sites of his new protein (from hw 6).
           Please help him to identify any biologically significant sites or patterns.
       Go Answer (1)
      (2) Please help him to analyze the enzymatic digestion by trypsin and endoproteinase Glu-C.
       Go Answer (2)
      (3) Calculate the molecular weight of this protein.
       Go Answer (3)

2. Pick up one bioinformatic site and prepare to introduce to your classmates on 1/8.

(1) David Liu would like to know the possible functional sites of his new protein (from hw 6). Please help him to identify any biologically significant sites or patterns.
    1 MLECNELIPLFYETCPAGENICYEMFMVATPKVPCERGCIDVCPESSLIV
   51 KYVCCNTDRC

ProSite Search Result for toxin

          PS00005 (PDOC00005) Protein kinase C phosphorylation site. 
                    Pattern: [ST]-x-[RK].
                    Matching residues 30-32: MFMVA TPK VPCER
                    Matching residues 57-59: YVCCN TDR C

          PS00272 (PDOC00245) Snake toxins signature. 
                    Pattern: G-C-x(1,3)-C-P-x(8,10)-C-C-x(2)-[PDEN].
                    Matching residues 38-58: VPCER GCIDVCPESSLIVKYVCCNTD RCQ
Back to Questions

(2) Please help him to analyze the enzymatic digestion by trypsin and endoproteinase Glu-C.
Back to Questions

(3) Calculate the molecular weight of this protein.

Molecular Mass = 6789.07

Back to Questions


Mail to me:b821605@life.nthu.edu.tw