David Liu, a student in department of Life Sciences, got bit by a snake in the backyard of life science
building. He was so angry! Thus, he killed the snake and purified several toxins from its venoms. He
sequenced one of the toxin, got this sequence:

1 L K C N K L V P L F Y K T C P A G K N L C Y K M F M V A T P

31 K V P V K R G C I D V C P K S S L L V K Y V C C N T D R C N

(1) Is this a new toxin? Please help him to identify this toxin.

(2) Can you find proteins that share sequence homology with this toxin?

Show them in multiple alignment form.

(3) Please predict its secondary structure.

          .   10    .   20    .   30    .   40    .   50    .   60
       LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
 helix H                 HHH     HHHH                              
 sheet     EEEEEEEEE        EEEEE      E E  EEEEE    EEEEEEEE      
 turns  TTT          TTTT            T  T TT     TTTT        TTTTTT
 coil               C                 C                            

(4) Please show its charge distribution.

CHARGE DISTRIBUTIONAL ANALYSIS
 
       1  0+00+00000 0+00000+00 00+0000000 +000++000- 000+00000+ 000000-+00

A. CHARGE CLUSTERS.


Positive charge clusters (cmin = 13/30 or 18/45 or 22/60):  none


Negative charge clusters:  not evaluated (frequency of - < 5%, too low)


Mixed charge clusters (cmin = 15/30 or 20/45 or 25/60):  none