1.
1. It is a new toxin. because of no protein sequence match it.

2. Finding the protein homology a following:


3. Predict its secondary structure
unknown toxin sequence

                                  60 aa
                                                 .         .         .         .         .         .
                                        LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN
                                  helix <--------->        <------------->       <-------->         
                                  sheet     EEEEEEEEE      EEEEEEEEE         EEEE     EEEEEEEEE     
                                  turns                  T           T     T       TT               


                                  Residue totals: H: 36   E: 31   T:  5
                                         percent: H: 60.0 E: 51.7 T:  8.3

                                         

4. Show its charge distribution
CHARGE DISTRIBUTIONAL ANALYSIS

                       LKCNKLVPLF YKTCPAGKNI CYKMFMVATP KLPVKRGCID VCPKSSLLVR YVCCNTDKCN
                       0+00+00000 0+00000+00 00+0000000 +000++000- 000+00000+ 000000-+00

                       A. CHARGE CLUSTERS.
                             Positive charge clusters (cmin = 13/30 or 18/45 or 22/60):  none
                             Negative charge clusters:  not evaluated (frequency of - < 5%, too low)
                             Mixed charge clusters (cmin = 15/30 or 20/45 or 25/60):  none

                       B. HIGH SCORING (UN)CHARGED SEGMENTS.

                         High scoring positive charge segments:

                             score=   2.00 frequency=   0.183  ( KR )
                             score=   0.00 frequency=   0.000  ( BZX )
                             score=  -1.00 frequency=   0.783  ( LAGSVTIPNFQYHMCW )
                             score=  -2.00 frequency=   0.033  ( ED )

                             Expected score/letter:  -0.483
                             - now scoring for positive charge segments;    Average information/letter: 0.430
                             Minimal length of displayed segments set to:  20

                             M_0.01= 13.07  (cv=  7.77, lambda=  0.52686, k=  0.16371, x=  5.30;
                                       90% confidence interval for segment length:  23 +-  25)
                             M_0.05=  9.97  (x=  2.20)

                             # of segments (>=20 residues) exceeding M_0.05: none

                         High scoring negative charge segments:

                             score=   2.00 frequency=   0.033  ( ED )
                             score=   0.00 frequency=   0.000  ( BZX )
                             score=  -1.00 frequency=   0.783  ( LAGSVTIPNFQYHMCW )
                             score=  -2.00 frequency=   0.183  ( KR )

                             Expected score/letter:  -1.083
                             - now scoring for negative charge segments;    Average information/letter: 3.490
                             Minimal length of displayed segments set to:  20

                             M_0.01=  4.94  (cv=  2.54, lambda=  1.61122, k=  0.47671, x=  2.40;
                                       90% confidence interval for segment length:   3 +-   3)
                             M_0.05=  3.92  (x=  1.38)

                             # of segments (>=20 residues) exceeding M_0.05: none

                         High scoring mixed charge segments:

                             score=   1.00 frequency=   0.217  ( KEDR )
                             score=   0.00 frequency=   0.000  ( BZX )
                             score=  -1.00 frequency=   0.783  ( LAGSVTIPNFQYHMCW )

                             Expected score/letter:  -0.567
                             - now scoring for mixed charge segments;    Average information/letter: 1.051
                             Minimal length of displayed segments set to:  20

                             M_0.01=  6.07  (cv=  3.19, lambda=  1.28520, k=  0.40993, x=  2.89;
                                       90% confidence interval for segment length:  11 +-   9)
                             M_0.05=  4.80  (x=  1.62)

                             # of segments (>=20 residues) exceeding M_0.05: none

                         High scoring uncharged segments:

                             score=   1.00 frequency=   0.783  ( LAGSVTIPNFQYHMCW )
                             score=   0.00 frequency=   0.000  ( BZX )
                             score=  -8.00 frequency=   0.217  ( KEDR )

                             Expected score/letter:  -0.950
                             - now scoring for uncharged segments;    Average information/letter: 0.173
                             Minimal length of displayed segments set to:  20

                             M_0.01= 32.53  (cv= 20.56, lambda=  0.19916, k=  0.10900, x= 11.97;
                                       90% confidence interval for segment length:  54 +-  44)
                             M_0.05= 24.34  (x=  3.79)

                             # of segments (>=20 residues) exceeding M_0.05: none

                       C. CHARGE RUNS AND PATTERNS.

                             pattern  (+)|  (-)|  (*)|  (0)| (+0)| (-0)| (*0)|(+00)|(-00)|(*00)|
                             lmin0     5 |   3 |   6 |  29 |  10 |   6 |  10 |  11 |   6 |  12 | 
                             lmin1     6 |   4 |   7 |  36 |  12 |   7 |  12 |  14 |   8 |  14 | 
                             lmin2     7 |   4 |   8 |  39 |  13 |   8 |  14 |  15 |   9 |  16 | 

                             There are no charge runs or patterns exceeding the given minimal lengths.

                             Run count statistics:

                               +  runs >=   3:   0
                               -  runs >=   3:   0
                               *  runs >=   4:   0
                               0  runs >=  20:   0