ANSWER:
LOCUS:       NTLTP1       3112 bp    DNA             PLN       18-NOV-1996
DEFINITION:  N.tabacum ltp1 gene for lipid transferase.
ACCESSION:   X62395
NID:         g1679608
KEYWORDS:    lipid transferase; Ltp1 gene; non-specific lipid transferase.
SOURCE:      common tobacco.
  ORGANISM:  Nicotiana tabacum
            Eukaryotae; mitochondrial eukaryotes; Viridiplantae;Charophyta/Embryophyta group;
            Embryophyta; Magnoliophyta;Magnoliopsida; Solananae; Solanales; Solanaceae; Nicotiana.
REFERENCE   1  (bases 1 to 3112)
  AUTHORS:   Kuhlemeier,C.
  TITLE:     Direct Submission
  JOURNAL:   Submitted (19-DEC-1991) C. Kuhlemeier, Institute of Plant
            Physiology, Altenbergrain 21, Ch-3013 Bern, SWITZERLAND
  REMARK:    Revised by [3]
REFERENCE   2  (bases 1038 to 3112)
  AUTHORS:   Fleming,A.J., Mandel,T., Hofmann,S., Sterk,P., de Vries,S.C. and
            Kuhlemeier,C.
  TITLE:     Expression pattern of a tobacco lipid transfer protein gene within
            the shoot apex
  JOURNAL:   Plant J. 2 (6), 855-862 (1992)
  MEDLINE:   93258425
REFERENCE   3  (bases 1 to 3112)
  AUTHORS:   Caderas,D.
  TITLE:     Direct Submission
  JOURNAL:   Submitted (18-NOV-1996) D. Caderas, Institute of Plant Physiology,
            University of Berne, Altenbergrain 21, CH-3013 Berne, SWITZERLAND
REFERENCE   4  (bases 1 to 3112)
  AUTHORS:   Canevascini,S., Caderas,D., Mandel,T., Fleming,A.J., Dupuis,I. and
            Kuhlemeier,C.
  TITLE:     Tissue-specific expression and promoter analysis of the tobacco
            Itp1 gene
  JOURNAL:   Plant Physiol. 112 (2), 513-524 (1996)
  MEDLINE:   97037728
FEATURES:             Location/Qualifiers
     source          1..3112
                     /organism="Nicotiana tabacum"
                     /cultivar="Samsun"
                     /db_xref="taxon:4097"
                     /dev_stage="leaf"
                     /clone_lib="lambda EMBL3"
     sig_peptide     1347..1415
                     /gene="Ltp1"
     CDS             join(1347..1681,2662..2671)
                     /gene="Ltp1"
                     /codon_start=1
                     /product="lipid transferase"
                     /db_xref="PID:g19883"
                     /translation="MEIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNT
                     GPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPY
                     KISPSTDCSKVQ"
     prim_transcript <1347..>2671
                     /gene="Ltp1"
     exon            <1347..1681
                     /gene="Ltp1"
                     /number=1
     gene            1347..2671
                     /gene="Ltp1"
     mat_peptide     join(1416..1681,2662,1680..1681,2662..2668)
                     /gene="Ltp1"
                     /product="lipid transferase"
     intron          1682..2661
                     /gene="Ltp1"
                     /number=1
     exon            2662..>2671
                     /gene="Ltp1"
                     /number=2
BASE COUNT     1009 a    533 c    510 g   1060 t

PROTEIN SEQUENCE:
        1 meiagkiacf vvlcmvvaap caeaitcgqv tsnlapclay lrntgplgrc cggvkalvns
       61 arttedrqia ctclksaaga isginlgkaa glpstcgvni pykispstdc skvq

2. How many nucleotide and protein sequence of Lycopersiconesculentum were know?
    Please find its class II small heat shock protein mRNA,complete cds.

ANSWER: 
Lycopersicon esculentum
Known sequence: 855 nucleotide ;1104 protein.(untill 1997.12.9)

LOCUS       LEU72396      738 bp    mRNA            PLN       14-JAN-1997
DEFINITION  Lycopersicon esculentum class II small heat shock protein
            Le-HSP17.6 mRNA, complete cds.
ACCESSION   U72396
NID         g1773290
KEYWORDS    .
SOURCE      tomato.
  ORGANISM  Lycopersicon esculentum
            Eukaryotae; mitochondrial eukaryotes; Viridiplantae;
            Charophyta/Embryophyta group; Embryophyta; Magnoliophyta;
            Magnoliopsida; Solananae; Solanales; Solanaceae; Solanum clade;
            Lycopersicon.
REFERENCE   1  (bases 1 to 738)
  AUTHORS   Kadyrzhanova,D.K., Vlachonasios,K.E., Ververidis,P. and Dilley,D.R.
  TITLE     A heat-treatment chilling tolerance related cDNA from tomato fruit
            encoding a small heat-shock protein class II
  JOURNAL   Unpublished (1996)
REFERENCE   2  (bases 1 to 738)
  AUTHORS   Kadyrzhanova,D.K., Vlachonasios,K.E., Ververidis,P. and Dilley,D.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-SEP-1996) Horticulture, Michigan State University,
            Plant and Soil Science Building, East Lansing, MI 48824-1325, USA
FEATURES             Location/Qualifiers
     source          1..738
                     /organism="Lycopersicon esculentum"
                     /cultivar="Mountain Springs"
                     /db_xref="taxon:4081"
                     /clone_lib="tomato heat-shock/chilling tolerance lambda
                     gt11 library of D.R. Dilley"
                     /dev_stage="mature green fruit"
                     /tissue_type="pericarp"
                     /clone="pHCT1"
     CDS             108..584
                     /note="heat treatment/chilling tolerance related protein
                     from tomato fruit"
                     /codon_start=1
                     /product="class II small heat shock protein Le-HSP17.6"
                     /db_xref="PID:g1773291"
                     /translation="MDLRLLGIDNTPLFHTLHHMMEAAGEDSDKSVNAPSRNYVRDAK
                     AMAATPADVKEYPNSYVFVVDMPGLKSGDIKVQVEEDNVLLISGERKREEEKEGAKFI
                     RMERRVGKFMRKFSLPENANTDAISAVCQDGVLTVTVQKLPPPEPKKPKTIEVKVA"
     polyA_signal    629..634
BASE COUNT      229 a    117 c    183 g    209 t