GARNIER Results

Predict secondary structure of protein sequences using the method of Garnier, Osguthorpe, and Robson, J. Mol. Biol., (1978) 120:97-120.

Algorithm Citation:
Garnier, Osguthorpe, and Robson, J. Mol. Biol., (1978) 120:97-120.
Program Citation:
© 1995 by William R. Pearson and the University of Virginia (This is from distribution "fasta20u3b", version 2.0u, Aug., 1995, modified; any errors are due to the modification; sale or incorporation into a commercial product expressly forbidden without permission).

toxin

Garnier plot of toxin
 60 aa; DCH = 0, DCS = 0
 
           .   10    .   20    .   30    .   40    .   50    .   60
       LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN
 helix H                         HHHH                              
 sheet     EEEEEEEEE      EEEEEEE           EEEEE    EEEEEEE       
 turns  TTT          TTTTT           T TTTTT     TTTT       TTTTTTT
 coil               C                 C                            

       
       
 helix 
 sheet 
 turns 
 coil  

 Residue totals: H:  5   E: 28   T: 25   C:  2
        percent: H: 11.4 E: 63.6 T: 56.8 C:  4.5


Copyright (C) 1997, Board of Trustees of the University of Illinois.