CHOFAS
Predict secondary protein structure (Chou-Fasman plot).
Algorithm Citation:
Chou P.Y., Fasman G.D. "Prediction of the secondary structure of proteins from their amino acid sequence." Adv. Enzymol. 47:45-148(1978).
Program Citation:
© 1995 by William R. Pearson and the University of Virginia (This is from distribution "fasta20u3b", version 2.0u, Aug., 1995, modified; any errors are due to the modification; sale or incorporation into a commercial product expressly forbidden without permission).
toxin
toxin 
 60 aa


                .         .         .         .         .         .
       LKCNKLVPLFYKTCPAGKNICYKMFMVATPKLPVKRGCIDVCPKSSLLVRYVCCNTDKCN
 helix <--------->        <------------->       <-------->         
 sheet     EEEEEEEEE      EEEEEEEEE         EEEE     EEEEEEEEE     
 turns                  T           T     T       TT               

       
       
 helix 
 sheet 
 turns 

 Residue totals: H: 36   E: 31   T:  5
        percent: H: 60.0 E: 51.7 T:  8.3
Copyright (C) 1997, Board of Trustees of the University of Illinois.