It is not a new protein.
The name of this protein is Oryza sativa lipid transfer protein.

Total number of negatively charged residues (Asp + Glu): 6
Total number of positively charged residues (Arg + Lys):12

The hydrophobicity map for this protein using Eisenberg hydrophobicity scale with window size 7. The relative weight of the window edges compared to the window center should set to 40%.

 

There are hydrophobic regions in the protein. It may be a transmembrane region.

Possible functions or pattern of this protein.
[1] PDOC00006 PS00006  CK2_PHOSPHO_SITE
Casein kinase II phosphorylation site

             66-69 TTAD
 

[2] PDOC00008 PS00008  MYRISTYL
N-myristoylation site

Number of matches: 3
      1      29-34 GQVVST
      2      46-51 GVAPTG
      3      52-57 GCCDGV

[3] PDOC00516 PS00597  PLANT_LTP
Plant lipid transfer proteins signature

            95-116 IPSKCGVNIPYAISPSTDCSRV

Color the protein by the hydrophobicity of the amino acids.
MARAGHNKYVARVMVVALLLAARAPVTCGQVVSTWAPCIMYADGEGVAPTGGCCDGVRTLNSAAATTADR
QTTCACLKQQTKAMGRLRPDHVAGIPSKCGVNIPYAISPSTDCSRVH
Total number of ALIVMW in sequence : 45