Chinese cobra

Sequence Homology with This Toxin

Secondary Structure 


 60 aa; DCH = 0, DCS = 0
 
           .   10    .   20    .   30    .   40    .   50    .   60
       LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
 helix H                 HHH     HHHH                              
 sheet     EEEEEEEEE        EEEEE      E E  EEEEE    EEEEEEEE      
 turns  TTT          TTTT            T  T TT     TTTT        TTTTTT
 coil               C                 C                            

       
 Residue totals: H:  8   E: 29   T: 21   C:  2
        percent: H: 18.2 E: 65.9 T: 47.7 C:  4.5






Charge Distribution 

 






       1  0+00+00000 0+00000+00 00+0000000 +000++000- 000+00000+ 000000-+00





CHARGE CLUSTERS.


Positive charge clusters (cmin = 13/30 or 18/45 or 22/60):  none

Negative charge clusters:  not evaluated (frequency of - < 5%, too low)

Mixed charge clusters (cmin = 15/30 or 20/45 or 25/60):  none