






1. Sho-Hua cloned a gene in the lab.
Please help him to identify the gene and its possible function.
Copy and paste the sequences that sho-hua cloned in the lab.
Blast with NCBI blast2.0 search, it seems that the sequences
are murine leukemia virus retroviral vector
Click here to see the full
result of query
2. How many nucleotide and protein sequence of Lycopersicon esculentum were know?
Please find its class II small heat shock protein mRNA, complete cds.
There have 1273 nucleotides and 1168 proteins of Lycopersicon esculentum were known.
Lycopersicon esculentum is what we know the tomato, its class II small heat shock protein
Le-HSP17.6 mRNA, complete cds were queried and the result are shown as below:
LOCUS LEU72396 738 bp mRNA PLN 23-APR-1998
DEFINITION Lycopersicon esculentum class II small heat shock protein
Le-HSP17.6 mRNA, complete cds.
ACCESSION U72396
NID g1773290
KEYWORDS .
SOURCE tomato.
ORGANISM Lycopersicon esculentum
Eukaryota; Viridiplantae; Charophyta/Embryophyta group;
Embryophyta; Tracheophyta; seed plants; Magnoliophyta;
eudicotyledons; Asteridae; Solananae; Solanales; Solanaceae;
Solanum clade; Lycopersicon.
REFERENCE 1 (bases 1 to 738)
AUTHORS Kadyrzhanova,D.K., Vlachonasios,K.E., Ververidis,P. and Dilley,D.R.
TITLE Molecular cloning of a novel heat induced/chilling tolerance
related cDNA in tomato fruit by use of mRNA differential display
JOURNAL Plant Mol. Biol. 36 (6), 885-895 (1998)
MEDLINE 981
79102
REFERENCE 2 (bases 1 to 738)
AUTHORS Kadyrzhanova,D.K., Vlachonasios,K.E., Ververidis,P. and Dilley,D.R.
TITLE Direct Submission
JOURNAL Submitted (24-SEP-1996) Horticulture, Michigan State University,
Plant and Soil Science Building, East Lansing, MI 48824-1325, USA
FEATURES Location/Qualifiers
source 1..738
/organism="Lycopersicon esculentum"
/cultivar="Mountain Springs"
/db_xref="taxon:4081"
/clone_lib="tomato heat-shock/chilling tolerance lambda
gt11 library of D.R. Dilley"
/dev_stage="mature green fruit"
/tissue_type="pericarp"
/clone="pHCT1"
CDS 108..584
/note="heat treatment/chilling tolerance related protein
from tomato fruit"
/codon_start=1
/product="class II small heat shock protein Le-HSP17.6"
/db_xref="PID:g1773291"
/translation="MDLRLLGIDNTPLFHTLHHMMEAAGEDSDKSVNAPSRNYVRDAK
AMAATPADVKEYPNSYVFVVDMPGLKSGDIKVQVEEDNVLLISGERKREEEKEGAKFI
RMERRVGKFMRKFSLPENANTDAISAVCQDGVLTVTVQKLPPPEPKKPKTIEVKVA"
polyA_signal 629..634
BASE COUNT 229 a 117 c 183 g 209 t
ORIGIN
1 tacggctgcg agaagacgac agaaggggac tgcaattaca aatcaaacca aaattgacaa
61 atttcacgca caaaatcaca atatccaaaa atttctcaat actgaaaatg gatttgaggt
121 tgttgggtat cgataacaca ccactcttcc acactctcca ccatatgatg gaagctgccg
181 gtgaagattc cgacaagtct gtcaatgcac catcaaggaa ctatgttcgt gatgctaagg
241 ccatggctgc tacaccagcg gatgtgaagg agtatcctaa ttcgtatgtt tttgttgtgg
301 atatgccagg gttgaaatct ggagatatca aagtgcaggt ggaagaagac aatgtgctgt
361 tgattagtgg tgaaaggaag agggaagaag agaaagaagg tgcaaagttt attaggatgg
421 agagaagggt tgggaaattc atgaggaagt ttagtctgcc agagaatgcg aatactgatg
481 caatttctgc agtttgtcaa gatggagttc tgactgttac tgttcagaaa ttgcctcctc
541 ctgagccaaa gaaacccaaa acaattgagg tgaaagttgc ttgaagttat ggactctgtt
601 ttgatggttt gtggtatgat gtagtagaaa taaagttgta ggagtagtga acttttcctt
661 tcatctttct gctatgtttt cacgtctgtt tgaatgttac aatagccatg ggtattgttt
721 gttttgatgc caaaaaaa
Back to homework