1. Sho-Hua cloned a gene in the lab.

Please help him to identify the gene and its possible function.

Copy and paste the sequences that sho-hua cloned in the lab.
Blast with NCBI blast2.0 search, it seems that the sequences 
are murine leukemia virus retroviral vector

Click here to see the full
result of query


 
2. How many nucleotide and protein sequence of Lycopersicon esculentum were know?

    Please find its class II small heat shock protein mRNA, complete cds.

There have 1273 nucleotides and 1168 proteins of Lycopersicon esculentum were known. 
Lycopersicon esculentum is what we know the tomato, its class II small heat shock protein
Le-HSP17.6 mRNA, complete cds were queried and the result are shown as below:


LOCUS       LEU72396      738 bp    mRNA            PLN       23-APR-1998
    DEFINITION  Lycopersicon esculentum class II small heat shock protein
                Le-HSP17.6 mRNA, complete cds.
    ACCESSION   U72396
    NID         g1773290
    KEYWORDS    .
    SOURCE      tomato.
      ORGANISM  Lycopersicon esculentum

                Eukaryota; Viridiplantae; Charophyta/Embryophyta group;
                Embryophyta; Tracheophyta; seed plants; Magnoliophyta;
                eudicotyledons; Asteridae; Solananae; Solanales; Solanaceae;
                Solanum clade; Lycopersicon.
    REFERENCE   1  (bases 1 to 738)
      AUTHORS   Kadyrzhanova,D.K., Vlachonasios,K.E., Ververidis,P. and Dilley,D.R.
      TITLE     Molecular cloning of a novel heat induced/chilling tolerance
                related cDNA in tomato fruit by use of mRNA differential display
      JOURNAL   Plant Mol. Biol. 36 (6), 885-895 (1998)
      MEDLINE   981
    79102
    REFERENCE   2  (bases 1 to 738)
     AUTHORS   Kadyrzhanova,D.K., Vlachonasios,K.E., Ververidis,P. and Dilley,D.R.
      TITLE     Direct Submission
      JOURNAL   Submitted (24-SEP-1996) Horticulture, Michigan State University,
                Plant and Soil Science Building, East Lansing, MI 48824-1325, USA
    FEATURES             Location/Qualifiers
         source          1..738
                         /organism="Lycopersicon esculentum"
                         /cultivar="Mountain Springs"
                         /db_xref="taxon:4081"
                         /clone_lib="tomato heat-shock/chilling tolerance lambda
                         gt11 library of D.R. Dilley"
                         /dev_stage="mature green fruit"
                         /tissue_type="pericarp"
                         /clone="pHCT1"
         CDS             108..584
                         /note="heat treatment/chilling tolerance related protein
                         from tomato fruit"
                         /codon_start=1
                         /product="class II small heat shock protein Le-HSP17.6"
                         /db_xref="PID:g1773291"
                         /translation="MDLRLLGIDNTPLFHTLHHMMEAAGEDSDKSVNAPSRNYVRDAK
                         AMAATPADVKEYPNSYVFVVDMPGLKSGDIKVQVEEDNVLLISGERKREEEKEGAKFI
                         RMERRVGKFMRKFSLPENANTDAISAVCQDGVLTVTVQKLPPPEPKKPKTIEVKVA"
         polyA_signal    629..634
    BASE COUNT      229 a    117 c    183 g    209 t
    ORIGIN
            1 tacggctgcg agaagacgac agaaggggac tgcaattaca aatcaaacca aaattgacaa
           61 atttcacgca caaaatcaca atatccaaaa atttctcaat actgaaaatg gatttgaggt
          121 tgttgggtat cgataacaca ccactcttcc acactctcca ccatatgatg gaagctgccg
          181 gtgaagattc cgacaagtct gtcaatgcac catcaaggaa ctatgttcgt gatgctaagg
          241 ccatggctgc tacaccagcg gatgtgaagg agtatcctaa ttcgtatgtt tttgttgtgg
          301 atatgccagg gttgaaatct ggagatatca aagtgcaggt ggaagaagac aatgtgctgt
          361 tgattagtgg tgaaaggaag agggaagaag agaaagaagg tgcaaagttt attaggatgg
          421 agagaagggt tgggaaattc atgaggaagt ttagtctgcc agagaatgcg aatactgatg
          481 caatttctgc agtttgtcaa gatggagttc tgactgttac tgttcagaaa ttgcctcctc
          541 ctgagccaaa gaaacccaaa acaattgagg tgaaagttgc ttgaagttat ggactctgtt
          601 ttgatggttt gtggtatgat gtagtagaaa taaagttgta ggagtagtga acttttcctt
          661 tcatctttct gctatgtttt cacgtctgtt tgaatgttac aatagccatg ggtattgttt
          721 gttttgatgc caaaaaaa