Kevin Lee, a graduate student in the department of life sciences, has purified a protein from rice. Here is the sequence of this protein -
ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACN
CLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS
1. Please help him to identify this protein in PDB.


4. Show protein in cartoon with
its four disulfide bonds in yellow color.

5. Measure the bond length of each disulfide bond ( -S-S- ) and calculate the average bond length of disulfide bond.
Answer: (2.02 A + 2.02 A + 2.01 A + 2.00 A)/4 = 2.0125 A