Kevin Lee, a graduate student in the department of life sciences, has purified a protein from rice. Here is the sequence of this protein - ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS

1. Please help him to identify this protein in PDB.> Rice nonspecific lipid transfer protein
 

2. Find the following data from its header file:

PDB ID> 1RZL

Experimental method> X-ray diffraction. Temp. 290 K. pH-7.8

Location of its four helixs (i.e. Ala12 - Gly20)>

Positions of its four disulfide bonds ( i.e. Cys3 - Cys24) > 3-50,  13-27,  28-73,  48-87.

Name of the hetero atoms>

3. Show two diferent views of this protein by Rasmol.

4. Show protein in cartoon with its four disulfide bonds in yellow color.

5. Measure the bond length of each disulfide bond ( -S-S- ) and calculate the average bond length of disulfide bond.

3-50    ----- 2.022 Å

13-27  ----- 2.010 Å

28-73  ----- 2.021 Å

48-87  ----- 2.014 Å

Average bond length of disulfide bond ------ 2.017 Å