HOMEWORK #7
| 1. Using DNA -> Protein translator to translate gene. |
|
MNKPQTIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGG |
| 2. Calaulate pI, molecular weight, amino acid composition of the protein. |
| Number of amino
acids: 121 Molecular weight: 13683.8 Theoretical pI: 8.78 Amino acid composition: Ala (A) 11 9.1% Arg (R) 2 1.7% Asn (N) 9 7.4% Asp (D) 7 5.8% Cys (C) 0 0.0% Gln (Q) 5 4.1% Glu (E) 8 6.6% Gly (G) 8 6.6% His (H) 6 5.0% Ile (I) 5 4.1% Leu (L) 12 9.9% Lys (K) 15 12.4% Met (M) 7 5.8% Phe (F) 5 4.1% Pro (P) 3 2.5% Ser (S) 0 0.0% Thr (T) 9 7.4% Trp (W) 0 0.0% Tyr (Y) 3 2.5% Val (V) 6 5.0% Asx (B) 0 0.0% Glx (Z) 0 0.0% Xaa (X) 0 0.0% Total number of negatively charged residues (Asp + Glu): 15 Total number of positively charged residues (Arg + Lys): 17 |
| 3. Predict a-helice of the protein. |
| Using the scale
alpha-helix / Deleage & Roux, the individual values for the 20 amino acids are: Ala: 1.489 Arg: 1.224 Asn: 0.772 Asp: 0.924 Cys: 0.966 Gln: 1.164 Glu: 1.504 Gly: 0.510 His: 1.003 Ile: 1.003 Leu: 1.236 Lys: 1.172 Met: 1.363 Phe: 1.195 Pro: 0.492 Ser: 0.739 Thr: 0.785 Trp: 1.090 Tyr: 0.787 Val: 0.990 Asx: 0.848 Glx: 1.334 Xaa: 1.020 |
 |
| 4. Compute the hydrophobic profile of the protein (show the window and weight you used). |
| Using the scale Hphob. / Kyte & Doolittle, the individual values for the 20 amino acids are: Ala: 1.800 Arg: -4.500 Asn: -3.500 Asp: -3.500 Cys: 2.500 Gln: -3.500 Glu: -3.500 Gly: -0.400 His: -3.200 Ile: 4.500 Leu: 3.800 Lys: -3.900 Met: 1.900 Phe: 2.800 Pro: -1.600 Ser: -0.800 Thr: -0.700 Trp: -0.900 Tyr: -1.300 Val: 4.200 Asx: -3.500 Glx: -3.500 Xaa: -0.490 window 15 weight 100% |
 |