1) Some functional sites for cardiotoxin: a. PS00005 (PDOC00005) Protein kinase C phosphorylation site. Pattern: [ST]-x-[RK]. Matching residues 2-4: K TIK YVMLE Matching residues 34-36: EMFMA TPK VPCER Matching residues 61-63: YVCCN TDR CQZSS b. PS00272 (PDOC00245) Snake toxins signature. Pattern: G-C-x(1,3)-C-P-x(8,10)-C-C-x(2)-[PDEN]. Matching residues 42-62: VPCER GCIDVCPESSLIVKYVCCNTD RCQZS
2) Enzymatic cleavage of cardiotoxin: a. Trpsin cleavage at residues: K/ or R/. (basic residues.) 1 * 10 * 20 * 30 * 40 * 50 1 KTIKYVMLECNELIPLFYECPAGENICYEMFMATPKVPCERGCIDVCPES 51 SLIVKYVCCNTDRCQZSSAZSLEIKA As we can see from its amino acid sequence above, the cleavage happens at residues: 4, 36, 41, 55, 63, 75, 77. *Clickherefor cleaved peptide masses. b. Endoprotease Glu-C Cleavage at residues: E/ As we can see from its amino acid sequence above, the cleavage happens at residues: 9,12,19,24,29,40,49,73,77. *Click here for cleaved peptide masses.
3) Molecular mass = 8665.22 +/- 0.98