Name of this protein

      Orysa nonspecific lipid-transfer protein 5 precursor ( LTP 5 )

Its DNA -> Protein translation

      MARAGHN KYVARVMVVALLLAARAPVTCGQVVSTWAP

     CIMYADGEGVAPTGGCCDGVRTLNSAAATTADRQTTCAC

     LKQQTKAMGRLRPDHVAGIPSKCGVNIPYAISPSTDCSRVH

Total number of negatively charged residues (Asp + Glu): 6
Total number of positively  charged residues (Arg + Lys):12

The hydrophobicity map for this protein using Eisenberg
(window size = 7 , window edges = 40% )           Here

　

Is there any hydrophobic region in this protein?

Can you explain the possible role for this region?

Yes. Transmembrane region.

Please help him to use Prosite scanning tool to find out

possible functions or pattern of this protein.       Here

Color the protein by the hydrophobicity of the amino acids.   Here