SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQA
GNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSF
LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYA
AVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRT
ILGSTILEDEFTPFDVVRQCSGVTFQ

1. Identify this protein.

SARS Corona Virus replicase polyprotein.

2. Find 8 similar proteins of the above protein from 8 different organisms in swissprot database. Give the name and ID number of each protein.

Organims: Murine hepatitis virus (strain JHM)
ID: P19751
Name: Replicase polyprotein 1ab

Organism: Bovine coronavirus (STRAIN QUEBEC)
ID: Q8V6W7
Name: Replicase polyprotein 1ab

Organism: Bovine enteric coronavirus (strain 98TXSF-110-ENT)
ID: Q91A29
Name: Replicase polyprotein 1ab

Organism: Bovine respiratory coronavirus (strain 98TXSF-110-LUN)
ID: Q8V439
Name: Replicase polyprotein 1ab

Organism: Porcine epidemic diarrhea virus (strain CV777)
ID: Q91AV2
Name: Replicase polyprotein 1ab

Organism: Feline infectious peritonitis virus (strain 79-1146)
ID: Q98VG9
Name: Replicase polyprotein 1ab

Organism: Porcine transmissible gastroenteritis coronavirus (STRAIN PURDUE)
ID: Q9IW06
Name: Replicase polyprotein 1ab

Organism: Human coronavirus 229E
ID: Q05002
Name: Replicase polyprotein 1ab

3. Perform "Multiple Sequence Alignment" of these proteins in Biological Workbench. Give the results of MSA. You should use organism name instead of ID number for each protein.

The results are HERE.

4. Show color-coded plot of alignment.

You could find a postscript version HERE.

5. Show the results of the rooted phylogenetic analysis.

You could find a postscript version HERE.